Identifiers and Description

Gene Model Identifier

Contig18521.0.g8

Standard Name

KELCH36

Aliases

Contig18521_0_g8

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012160904.001416569413617e-37hypothetical protein
SGDYCR084C0.00000039992052383199455TUP1 SGDID:S000000680, Chr III
from 262452-260311, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18521.0.g8(coding)
ATGGGCAATAAAAATTCAAACAAGCGACCTCTAAACATTCTCAAGATACCTATCTACGCA
ATTGGTTCGTATGGTGACTATGTGTTCTTAGGAGGTGGCGGAGGCTACGAAATTGAGAAT
AAAATAGAAGTTTATCAGCTTGAAAATCCTAGTCAGAATATTCTCAAGAAACTAGTGCAT
GAGGAACCATGTGGCGATGGAGTCCCTAATTATTTTGAATTGCCCAATCATAACTTGAAT
ATTTTGACAGCATGTGTATTCGCCAAGGTTGTATTTTACAAAATAGATGTAAAATCAGGG
AAGCTAGAAAAACTATAAGAATTTCAAGCCGATTTCAAAAAAGAAGAGGCTTCAGTAAAT
TGTTGCAAATACTCAAAAGATAATAGTCTACTTGCCACTGGAGGAGATGATTTTGTAGTA
AGAGTGTTTAAGCTAGATACAAAGGATTATAAATCAAGCGAGAAGATATTGGAGCTGCCA
GGTCATTATGAACCAATAAACGCAGTAGACTTCTCCCCAGATAAAAAACTGCTGATTTCT
TCATCCACAGATAAATCCTGCATTATTTTCAATCTTGAAAAGCGTGGGTAGAAAGTATAA
AAACTAACTTTCAATGATGGTTTGACATCAGAGTCGAAGAACATGCTTATGAGAGGTTGT
TTCTTCAGCAATGATGGGAAATTTATTTACACACTTGCCACTTAAACGCGTTCCAAATCT
TATTTGATTAAGTGGCAAAATAAAGAAAATTTTGATCCAGTTAAAGTCACATTGGTACAT
AATTAAACATCCTCAGGTATGCGTATATCTCCTAATGGAAAGTAAATTGGCATCATGACT
AGTGATGGATATGTAAAAGTAATGAATGAAGGTTCTGAAAATTTTATTGTGGAATAAAAG
CGCCACAGACTGCCTGTGACTTGCATGGGTTTTAAAACTGATTTCAGTGGAAAAGCAGAG
TACGTGCTTAGTGGCTCCCCAGATTACACCTATAACATTATTTCTTGCAATGTTTCAATC
TTTTAGAGAATAATGGGACTAATAAGATTCCTCTTAATTTTAATGATTATCGTGAGTGTG
GTTATTATGATACTATGA


>Contig18521.0.g8(protein)
MGNKNSNKRPLNILKIPIYAIGSYGDYVFLGGGGGYEIENKIEVYQLENPSQNILKKLVH
EEPCGDGVPNYFELPNHNLNILTACVFAKVVFYKIDVKSGKLEKLQEFQADFKKEEASVN
CCKYSKDNSLLATGGDDFVVRVFKLDTKDYKSSEKILELPGHYEPINAVDFSPDKKLLIS
SSTDKSCIIFNLEKRGQKVQKLTFNDGLTSESKNMLMRGCFFSNDGKFIYTLATQTRSKS
YLIKWQNKENFDPVKVTLVHNQTSSGMRISPNGKQIGIMTSDGYVKVMNEGSENFIVEQK
RHRLPVTCMGFKTDFSGKAEYVLSGSPDYTYNIISCNVSIFQRIMGLIRFLLILMIIVSV
VIMIL