Identifiers and Description

Gene Model Identifier

Contig2203.0.g7

Standard Name

KELCH30

Aliases

Contig2203_0_g7

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006846201.0001055852164665e-60Kelch motif family protein
SGDYHR158C0.000000000008998169033602767KEL1 SGDID:S000001201, Chr VII
I from 417179-413685, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2203.0.g7(coding)
ATGAGTTAAGATCTATAGGAATTTTAAACTTAAAGATACAATAGCAGTGTTAGAGAATTC
AGCTAGTATGTTCATAAAATTTAAGATATGCCTGTAATAAGAGTTAGCAAGAAGAAAGAA
AATAAAGACAATGATGATAATAGATTAGGAAGAAATTCGGCCTACGATAAAGGAATACAA
AAGACATCATAGTAAAAGTAGATATACTTTAACTCAATGATAACTTAAGACATGAAACTA
TATTGGGAAAAGATTCCAGCTATGAAATGGTCACCAGATTCAAGAGAAGGAGCAACTTTG
CTTTGCATCGAGCAGAAGATTTTCCTATTCGGAGGACTTTCTTCTAAATTACATAAGGAC
ACGGAAATTTTAGCCGCAAATAATTGGAGATGGCTAAAGCCTTAAGAATTCAAAGTTAGA
CATGCTCCAAATCCAAGATACGATTATTCAGCTGTTATTTATTTCGATCACATTATAGTA
TTTGGAGGATAGTAAACATATAATGCTTAAACTAAAATAAGAAATACTCTCAATGACTTG
TTGCTCTTCAATACTTAAACTTATGAGTGGGAATAAATTCACTATGGAGGCATGTTTTTT
GCAAGAAAATAGCATGTTGCAGCGATTGTATCGCATCATATGCTATTATTTGGTGGTTAA
AATGAAGAAGGATAATTTGAAGGTGGTCTTTTAGCTTTAAATCTAGGGACTTTTAAATGG
ATGCCTTGTCCAGTAGAAGGAGAAGATCCTGGAAAATTAATTCATTAAACTTGTGTGGTT
GTTGTACATCCAGAGAGAGCTCAAAAGAAATCTTTTTCTTTGTTTAAGAACCCTTCTGAT
ATGAAATACAGACAATTTAGTAGAATTGCCCATGAAGGTGTGTATTTCTTTGGAGGTAAA
CGACCTGATGGATTCTCTTCAAATTAATTACACGTCTTAAGAGTAGGTTGTAAGCCTTTG
TAATGGTTCCAACCAGAAATTAAGGGTAGTCCCCCCTCTGCTAGATATGGTCATACTATG
AATTACTTTGAACAAATGAATTGCATAATAATTTTTGGAGGTAGAAATGACACATTATTT
GAGAGGACAAGTAATAGTTAAGGCAACTTTTTAAATGATATGTGGCTTTTGCATTTAGAA
AATATGATTTGGATTCATGTCTCAAATATTGGAGATGTGCCAAGTCCAAGATATAGCATG
TAATCAGCTATATATGGCTCGAGACTTGTAATATTTGGTGGCTTGAATTCAAAAACTTAT
AATAACTCAGACTTGTATATCTGTGAACTTGACCCCATGCTCTCAAAATAATATGAAGCA
GAGAAAAACAGAAAGATACTTGACATTAAGAATCAATTGGCTAGAAATAAATATAGTTAA
GGTACAAATGGTATGGCTTCAGGGGATGAGGCTCAATCTTAAACAGCTTAAATATTGCAG
AAGTTCTTTGGTGAGAGACTCAAAAATAGTAAAATGCCACTTCCCTTAAACCTCATTAAC
TACCTTGAAAACAGACATCAGTAAATTGAGAAGTAAAGAATAAACGAAAGAGAATCGCAG
AAAAATCTTAAAATTTACACAGGAATATCCAAACATCAAATTGCTGATAGTCCAAACTTT
AATCTGAAGTCTCCACCGAACTATAACACTACAAATCAATCAGAGATTTTGCAATAATTC
GTAGCCAGTGCTGGTGTCTCAAGAATTGAAGAAGATTAAGAAGATGAAGGTGACAGCAAA
CGCAGCCTACTCGATGTCGCTTAATCATCAGGGTTGTCTCCACTTTAAAATGAGAGAAAT
GATGGGGAGTACATCTATAATTACGGTGCAAGAGGTTTGAGAAACCATGACGATAAAATA
ATAGACATCAGGAATGAACAACCTGACTTTGATATTAAAGACTCATCATTCGAAGAAGCC
GAGTCTTTCACAGTGCAGAAAAGTCAATGA


>Contig2203.0.g7(protein)
MSQDLQEFQTQRYNSSVREFSQYVHKIQDMPVIRVSKKKENKDNDDNRLGRNSAYDKGIQ
KTSQQKQIYFNSMITQDMKLYWEKIPAMKWSPDSREGATLLCIEQKIFLFGGLSSKLHKD
TEILAANNWRWLKPQEFKVRHAPNPRYDYSAVIYFDHIIVFGGQQTYNAQTKIRNTLNDL
LLFNTQTYEWEQIHYGGMFFARKQHVAAIVSHHMLLFGGQNEEGQFEGGLLALNLGTFKW
MPCPVEGEDPGKLIHQTCVVVVHPERAQKKSFSLFKNPSDMKYRQFSRIAHEGVYFFGGK
RPDGFSSNQLHVLRVGCKPLQWFQPEIKGSPPSARYGHTMNYFEQMNCIIIFGGRNDTLF
ERTSNSQGNFLNDMWLLHLENMIWIHVSNIGDVPSPRYSMQSAIYGSRLVIFGGLNSKTY
NNSDLYICELDPMLSKQYEAEKNRKILDIKNQLARNKYSQGTNGMASGDEAQSQTAQILQ
KFFGERLKNSKMPLPLNLINYLENRHQQIEKQRINERESQKNLKIYTGISKHQIADSPNF
NLKSPPNYNTTNQSEILQQFVASAGVSRIEEDQEDEGDSKRSLLDVAQSSGLSPLQNERN
DGEYIYNYGARGLRNHDDKIIDIRNEQPDFDIKDSSFEEAESFTVQKSQ