Identifiers and Description

Gene Model Identifier

Contig19149.0.g86

Standard Name

KELCH28

Aliases

Contig19149_0_g86

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000669100.0000000000010000211161514907Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19149.0.g86(coding)
ATGGAGAAAGAAGAGTGTTCAATATGTTTCTTTCAATACGATAAGCATCACAAGATCCCT
CGTATCCTCAGATGCGGCCACACTTTCTGTCAGACATGCCTCGATGAAATCAAGTTACCC
TCTAAACACTCCATCACTTGTCCTAATTGTAGAGTGAAAACAGAGAATGTAATTTGTACA
AAGAATCTACCAGAGAACGATGAGGTATTCAACCCACAAATGCGTATGTAGCATAGAGCT
CACTTTGTGAACTTAAACTCACCCTATGAAAGTGCCAAGAGATTGATGAGAGAGTGCAGT
TCACTTATGAACACTTCAGATCGATTTAATGAGTATCTAAACAAACTTTCACAATTGGAC
GAAAAAGCAGAGAATCAGCTACTCTCTAATTACGAATAGGAATACAACAAACTGGAAAGC
ATTTCTCAACTCCTGATTCAAATGATCACAGATTACAAAGATAAGCAGCAGCAGAAGCTC
ACAGATTCCCTCGTGCTCGAAAGAAACCAAATCAATATGCACATGAAACAGATTGAGGGG
CATCGGGGGCAAGTCAAGGACATCAAAAACGCCATTTAAGAGGAGGTGGAGGTTGAGTTA
AAAGCCATCCAGGAGAACGAAAGCGAGTACCTCAGATTGCAGAAGGAATACTTCAGGAGG
CTCTAGGAACAAGAAGAGGAGCAGTAACAGCAGTAGTAGTATGTTCAAGATTGCAATACT
AACAGCGAATTCTTGGCTGTAACCAATAGCAACGGGGGTGTAAGTTGCATGAAAAGTCAG
ATAACTGGGTAAACTATGCATGAACTTCATGCCAAAACTTAGAATGATTTGATGAAGCCA
GATAGTTGCATTAGTGGCATGAATGCTAGTTTGATGGCAGATTAGCATTAAAAGATAAAA
ATGTAAGAAGATATCTCTATAGCTCCAGATTTTGGCATGATTGGCGGCGGAGTGGCTAGT
TAAACAGATAAAATGAACATTAATATAATTGTGGGAGGTGTAGTCACCAACACAATCTCT
CAATTAAACAAGGATATTTTGTTGGACGTGGACTCTTCCGATTCCCTATCTTTAAAGTCA
GATTCTGATCAGTCGTGCAACAATCAGAAACTGAGAAAGTAGCAGTAAGAAAACAATCTT
TGCATAAATAGCTCGAGCAATAGTAGCTTGGTATTTAGAGAACTGTAAAAAGTAGATGTT
GGTGAAATTGAGTCTCTCGAACAAGAAGATAAAACTCGTGTAAACCAAGTTAGAAACTAA
TTCTACTCCATTAATCAGAAATTTGAACAATTACTGAAATTCAAATCAATCCAAAAAATC
AATCTCTGGCAAACAGAGTTAAACTTAGAACAAACCTACAACGTTTTCTCAACTTTCAAG
ATAAATGAGGTGCAGTAATCTTTTGAAGATGAAGTTCGTGATTTTGAGGCTTAGCTTGAC
TTGAAAGACTACTATGACGTTTAAAGACCTCAAGTTGTTTATTTGAGCTATCAGAACAAG
CAGTTGAAAGCTACTAAGATTGACATACTAAGCGACACTCACTTATAATCCTCTGTAAAG
TTAATTAACCCTCAATTGAACCAAAAACTGAACCTTAGTTCTTGCAAGGCCATCCCTCAC
CCCTCAAACACCTCTTACTATATTATCGACCAGGACAGATTCTATCTGTTTGACAGCGTT
AATGACATTTTAATATAGAAAAAGATTTGCAGTAGTTTGAAAAATACAAGCGGACATGCA
ATCACTCACACTGAGGGATTTATTTATTTAATTGGTGGATTTGATTTAAAGCTAAACAAA
AGCTTGAAGCAATGTTCAAGATACAATATTATTACTGAGAGATGGAGTTAATTGCAGCCT
ATGTTGTTTGATATTTCTGAAGCAGCTGCTTGCTCAATTAATGAATACCAAATTGTTGTG
GCAGGAGGAGTGAACTCACAGCACCGACTCACTGATATAGTTCAAATTTATAACATTAGA
GAAAATAGCTGGAGATTATTTGAAATTTGCCTATCATCTCCTCGCAGATAAATTAGTATG
ATCAGCTCCCAGAAAGATCGAGTTATGATTATAGGTGGAAGAGAAAACATTTAAAACATG
AATGGAAGTAACAATAGTGGAAGCTCTTAATTCAACATTAATGACAGAGAATGCTAGGTA
GTAGAGGAAATTGATTTCTTAAAAAGAAACATTGTTAATTTGGCTCCTTTGAAAGTCCCC
AGGTCCAACACCTCTGCATTCTAAGTAAACGACAGTATCTATGTGTTTGGTGGCAGCAAC
ACTACTTTGTAGCAATAATAGCAACTCCAATTCTAGTAGTAAAATCAGGGGGTGAATTAA
CAGTCTTCTCTAAACTCCATGATTGGTGAAAAGTACGTACTAAGAGAAAATAGATGGAGG
GAGATTAAATCAGCGAATGATTCCTCATAGAATAAATAGCAACAACTTTTCACTAATTAA
GCAATTGGAGCTGCTTGCTTGCTATATGAGTGA


>Contig19149.0.g86(protein)
MEKEECSICFFQYDKHHKIPRILRCGHTFCQTCLDEIKLPSKHSITCPNCRVKTENVICT
KNLPENDEVFNPQMRMQHRAHFVNLNSPYESAKRLMRECSSLMNTSDRFNEYLNKLSQLD
EKAENQLLSNYEQEYNKLESISQLLIQMITDYKDKQQQKLTDSLVLERNQINMHMKQIEG
HRGQVKDIKNAIQEEVEVELKAIQENESEYLRLQKEYFRRLQEQEEEQQQQQQYVQDCNT
NSEFLAVTNSNGGVSCMKSQITGQTMHELHAKTQNDLMKPDSCISGMNASLMADQHQKIK
MQEDISIAPDFGMIGGGVASQTDKMNINIIVGGVVTNTISQLNKDILLDVDSSDSLSLKS
DSDQSCNNQKLRKQQQENNLCINSSSNSSLVFRELQKVDVGEIESLEQEDKTRVNQVRNQ
FYSINQKFEQLLKFKSIQKINLWQTELNLEQTYNVFSTFKINEVQQSFEDEVRDFEAQLD
LKDYYDVQRPQVVYLSYQNKQLKATKIDILSDTHLQSSVKLINPQLNQKLNLSSCKAIPH
PSNTSYYIIDQDRFYLFDSVNDILIQKKICSSLKNTSGHAITHTEGFIYLIGGFDLKLNK
SLKQCSRYNIITERWSQLQPMLFDISEAAACSINEYQIVVAGGVNSQHRLTDIVQIYNIR
ENSWRLFEICLSSPRRQISMISSQKDRVMIIGGRENIQNMNGSNNSGSSQFNINDRECQV
VEEIDFLKRNIVNLAPLKVPRSNTSAFQVNDSIYVFGGSNTTLQQQQQLQFQQQNQGVNQ
QSSLNSMIGEKYVLRENRWREIKSANDSSQNKQQQLFTNQAIGAACLLYE