Identifiers and Description

Gene Model Identifier

Contig20452.0.1.g16

Standard Name

KELCH26

Aliases

Contig20452_0_1_g16

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005321809.999888128184441e-42Kelch motif family protein
SGDYGR238C9.004296568159186e-20KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20452.0.1.g16(coding)
ATGGAAGAAAAGAAACTAAGTGTAGACCCATTAAGAAAAGAAACTTCTACAAGAGTATAC
TAAACAAATAATGACAATGATACCAGTGGATTCAATACTAGATTAGATTTGGCACATTAA
AAACCCTCATTTATGGGGGAAGGATATAATGACAATTGGTATGAATTGAGATTTTCAAGC
ATTGGGCCTGATCGTAGAAGTTATCATTCAACTTTTCAGCACAATAAAAAGCTGTACATT
TATGGAGGTCATGATATTAGAGAGGGTTCAAAAGATTCATTATGGATGCTAGATTTAAGA
AAATTAAAGGATCTGGATTTAGATCCCACACTATAGAGTAAAGATTGCTAGTGGAAAGAA
ATATAAACAAAGGGAGATGATAAGCCTGGATGTTTAGCCCATCACACATCCGTTGTATTT
GGCGATAAAATGTACCTGTTTGGAGGCTCAAACTTAGAATCAGAGAACAGAAAATTCTTC
TCCCTTGACCTCAATCACTTCAGATGGGACGTTGTGAAATCACGTGGAGATTTGCCAATC
ACAAGAGATGAGCACACTTGCATAATCTATGAGAATGAAAGCTCTATGATCATTTTTGGA
GGGTTCTGTAATGGAGAGAGAACAAATGAGATTATTAAGTATTTGTTTCAGGAAAATAGA
TGGGTCAAATTAAACATGCCTCTTGGGGCAGTACAACCAAGCCCTAGAAGCGGTCATAGT
GCTTGTATATATGAAAATTCAATGTACGTGTTCGGTGGTAAAGACGATGATAATAATAAG
TTGAATGATTTGTGGAGATTGGATCTCAACAATTATCAATGGACTGAAATTAAACCTGTA
GATAACTACAAGCCAGTTGAAAGAAGTGGCCACTCAAGTGATGTCTTCGAAAATTTCTTC
GTTATATTTGGAGGAATTTTCGAGATCACTAAAGAGTTGAACGACTTTCATATGTTTGAC
TTCAAAAAGCAAAAGTGGATCACTATATTCGAAGAAGCTTCTTCACCTAAGAGAGATACT
AATCCCTATGGAAATGAAGATAATTCTCCATCAGCTGGAGGAAATAGTCCCAAAAAAGGA
GGTTCACCAATCTAAAGAAAGCTTGGTTCTCCTCCAAAAACCTCTTCAAAGATGCTTAAG
AGTTCAAGCAACTAAAAAGCGAAGAGATCTTTGAACTTAAATACCTCAACAACTGTAAAC
AGCCGTAACTCAAAGACAAGTGTAAATGCCATTATGGGTGTTTAGCTTACAACTCCTACT
TCAATCTCTATGATGAACTCTTTCATAATTAAAAACGCAGATACTAGCTTCGATCATTAC
TACACATCAATGAAAAAGCGCAAGCAAAGGCAAAAGACCAGCTGCTAGAGATGGACATAC
AGGAGTAATGTTTGGGAAATATTTCATAGTGTTTGGTGGTGA


>Contig20452.0.1.g16(protein)
MEEKKLSVDPLRKETSTRVYQTNNDNDTSGFNTRLDLAHQKPSFMGEGYNDNWYELRFSS
IGPDRRSYHSTFQHNKKLYIYGGHDIREGSKDSLWMLDLRKLKDLDLDPTLQSKDCQWKE
IQTKGDDKPGCLAHHTSVVFGDKMYLFGGSNLESENRKFFSLDLNHFRWDVVKSRGDLPI
TRDEHTCIIYENESSMIIFGGFCNGERTNEIIKYLFQENRWVKLNMPLGAVQPSPRSGHS
ACIYENSMYVFGGKDDDNNKLNDLWRLDLNNYQWTEIKPVDNYKPVERSGHSSDVFENFF
VIFGGIFEITKELNDFHMFDFKKQKWITIFEEASSPKRDTNPYGNEDNSPSAGGNSPKKG
GSPIQRKLGSPPKTSSKMLKSSSNQKAKRSLNLNTSTTVNSRNSKTSVNAIMGVQLTTPT
SISMMNSFIIKNADTSFDHYYTSMKKRKQRQKTSCQRWTYRSNVWEIFHSVWW