Identifiers and Description

Gene Model Identifier

Contig1034.1.g116

Standard Name

KELCH23

Aliases

Contig1034_1_g116

Description

Polycystin cation channel

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001917601.9991517704232713e-32hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1034.1.g116(coding)
ATGCAAAACTTACTCTCTTAAGCTTTAGCTTAAAGGTTCTCTTTGGCTCCACAAGTTGAT
GAAACTTACATCTAAGAAGTATTGGATGTCGATAGAGTAAACAACAAAGAAGAATTGAAA
GAATTTATTGAGGCAGTTTAATGCTTAATTTGCCTTGGAATTGTGAGAGATCCAGCGATG
GAGTGTTCAACATGCAACAGGCCCTTTTGCAAACTATGCTTGGATTCGTGGTAGCGTCAT
AATCGTACTTGCCCGATGAGATGTGAACGACCTTAGTTCTAAAAGATTCATAGAACTATC
AAGAACATCCTAACTAAGTTCAGATTCTAATGTAAATTCGAAAGTATGGGTTGCTTAGAA
TTGCCTTACTATGACAAGCTATCGAAGCACGAGTAAAATTGTACTTATGAGATTGAAACC
TGCGAAAAATGCCAAATTCAAATGCGAATCGTTGAGAAATCCACCCATGACTGCATAACC
TCCCTTAAAGTAGAAGTTTCTAAGCTTAAGAAACACGCAAAATCTAGGCTTTTGTATTAT
ACTTCAGGTGGCAGCTAGGATTTTCATATTTTTGATGAGAAAAACTTGGATTGGGAGAGC
TTCAAAATCAGTGGAGAATTTCATTTCCCGATATTAAGTCAGTTCGTAGTTACAAACAGC
AGTGGATTGGATTAAGAAGCTGATTAGAGAATGTAATAACTGGGCAGGTAAAATGAAAAC
ATCAGCACTAGAATATTTGGTATTGGTGGTATTAAAGACATCACAAAGGTTAGATCAGAG
GGCAATAAGTAAATATCTGAAAGAGTAACTGAACCGACTAAAGAGACTTTTGAAATATTT
ATAAATCTCTTAAGTGTTCAACCCAAGTAAAACATGAAAATAGCCAGAGCTATGTTTGGA
GTTGCTCTTGATCCATCTTCCACTTAAATATTTGTTGTTGGTGGTATTGATATCGAGAAG
AAAGAAATATCTGATTGTGAAGTGTATGACCTTAAGCAAAACATGTGGAGTAGCTTGCCA
AAGTTAACAACCCCAAGATCATCAGTATCATTAATAGTAATCAACTCCTCATTTATCTAT
TCTTTTGGAGGGTTCCCACTGTCCAACTCATCAATCGAGTTGTTCTATCAATCTAAATGG
CAGGCTATTCAACTCAAAGACGGGGATGATTTTATACATCCATTTTGGGCTGGTGCACAT
CTCTCCGATAAAATGAATGGATCAATCTACATATTTGGAGGTGGATTGAAATACAATGAT
TCTTAAGATATTTATGATTACAATGCTGACAATCGCTAGTTATCCAAACTTAAAATAACA
CTCCCAAAAGAAGATAGATTTTTCTACAATTCACAGAAAATAGTTCTAGGAGAAGATAAA
TTCATAACAATGGGAAGACACGGAGTTTATAAAATGGATTTACAAAGAAAAACTTGCTAT
AAATTAGCGGAGGATAAAGTCAACAACTAGGAAATCAAGGAGCCATTACTTAGTAAGTAA
GAGTCAAAGAGCCTGAAAGATCATCGACAGAGCTCACAACCAGACTATAGCAATATAAAG
ATTATCAACTCTAGTTCAAGCAGTTGGTCTCCTTACAGTTAAAAAGATAAAAATTAAGAA
TAAACTTAACCACAGGAATTCAAGAAGAAACCTCTTAATCCATTAGAAATATTTGCTCAG
AATGATAGGAAAAAGACATGTTTTAGGTTACTCCAGGATTTTTTCTAAGAGCCAGATATC
CCTCTCAAAGATAAAATTATTCTTGGGCCTGTTGATAAGTACATCAAGTACAAATCATAA
AATGAGACTACCCGCTCCCAAGAAAGAGTGTTTTACAAATATTTCTTCAATGAAGACGAA
AATTATGATTCGTTAGATCAGGGAAGAGTGAGAAATTTCTACGATGTCAATTCTTTCAGG
GAAATTATCAGTAATAGTGTGGAGAATTACTATACTATCAACGATCGAACTATGGAATAT
TATGACTATTTTTATACTGACAGCTCAATGCAGTAAATTAAGCCAGTTAAAATCTAATTG
TTCTATGCTGACGAATAGTTTACCCCACAAAATTATATGGAGGGATTTATAGAGGAAGAT
AGCAATTTCTTGGAAATCTCAAGAGAAAATTAGAAAATATTTGATTAACAGAAATTTTCA
AATGAGTAACTGAAAAGATTGATTGTGAGATTGGATAAAATCGAATTGGTCTATCATTTG
AGCTCCAAACTTTTAGATTCGAGACTTGCTAAACAATTCCCACTCTATCAATGGTTAATT
AAGCAGGAATTCAGCTTTTAAGACAGAAACCATATGTCTTTACGGCTTATGATAACAAAG
ATCTCAGCCACAGATGAATACGCAAGGGAGTACTGGACTTAGTATATTTGGATTGATATT
GGCATCATTTTGCTTGCTCTTAGTTCTATATTTTTCACTTGGAAGTATATTTATGAAGTG
GCCGTTCTCTATAACGAACTTAAACTCAAATTTGCGAAGAGTAGTTACTCGAAGGCTTAT
AAAGAATAGTAAAAAACGATAAATAAAATTAGAGAGAAGAATCTACGATATAAGAACGAG
TTGTCTATGGCTGGATCATAAAGAGGAGGCTCAGTAAAGGAAGACACTGATGAGAATGAT
TTAAGCGACAGTGACACTTTAGGAAACCATCAAAACAACCCTGGAGATATGAGTTAAAAG
ATAAATCCGTAAAACCAAGACAATTATTTCGATTAATCAGTGGCTACGAAACATATCTTG
GATAACAAAAGCAGATTGCAACAAGACTTCAATCTTGAACCTATGGTGCTGTGGGAAGAT
CTCACAGTCAATGATAAGATCAAACTCTTTAGTTATTGGACTATACTTTCTATAATAGGG
AGTTTCCTGCAGATATTTGGTTCACTGTCAAACATTATGAGCGTGTACAATATATTCGAG
ATTGATAGGCAAGGGGGAAATGTGGAATTACTGATAGGATTAGGGTGTATGATGGCTTGG
TTAGGTCTTGTTAGATATATGGAGTATAGTGAGGAATACTCGATTCTAGGCAGAACACTT
TCCCTGTCAGCTCCAAACGTGTTGAAGACCATGATAAGCACCTTGCCAGTTCTAATGGGC
TACACTTTCTTGGGCGTGGCACTATTCTATAAATCCAATAGATTTTCTAGTGCGACTGGA
GTACTGACCACTCTCTACGCTTTGATGTTTGGAGATATGGTTTATGACACTTTTTATGAT
TTGAGTTTCACTCATTTCTTCTACTCAAAGATTTACCTGTTCTCCTTCATATTCTTCTCG
ATTTGTGTGATAAATTCATTGTTCATATCAGTGATTGAAGATGCTTATGTGACTGCTAAG
TATACTTCTCGATTAGATATGTTTTTAGGCAGATAATCTTCACAGCTGCCCGTGAAACCA
TTATTGAGAGATCGTGAGCCTGAAGGTCTTAATATTGACGATGACTTGAAACTAAATCAG
CTACAGAAGCAAAGTAAGAAAGAATTAAAATCTCAGAAAGTACTGGAATAAATGATGGAA
TAATCATAAATTTAATATGATTAGAATATGAGTTCAAGGTAGATACATAAAGAACACTAG
CATTAATATCCACCAGGTTTGTCTTAAATATTAAAGAGGTCACTAACCTCACATCATTTC
CCCTATCAGAGATAGTTCTCATAATTCAAGAATGATGATGAGTCACAGAAAGAATTTAAT
AAGAAGAAATTACAGCTAAATTTGGAATTTAAAGAGGCTATTGATAGAATGGAGAATGTG
ATTAATTACACTGGAGAGATAATGCACATGTACAGAACAAACGAAATTAGTGAATAACAA
TACAGATAATTTAACTTGGAAATGGACAGCAAGATTGTATAGATGCAAAATATGCTCATA
CAATTAGAGGAAAAGAGCAAAAACACCTGA


>Contig1034.1.g116(protein)
MQNLLSQALAQRFSLAPQVDETYIQEVLDVDRVNNKEELKEFIEAVQCLICLGIVRDPAM
ECSTCNRPFCKLCLDSWQRHNRTCPMRCERPQFQKIHRTIKNILTKFRFQCKFESMGCLE
LPYYDKLSKHEQNCTYEIETCEKCQIQMRIVEKSTHDCITSLKVEVSKLKKHAKSRLLYY
TSGGSQDFHIFDEKNLDWESFKISGEFHFPILSQFVVTNSSGLDQEADQRMQQLGRQNEN
ISTRIFGIGGIKDITKVRSEGNKQISERVTEPTKETFEIFINLLSVQPKQNMKIARAMFG
VALDPSSTQIFVVGGIDIEKKEISDCEVYDLKQNMWSSLPKLTTPRSSVSLIVINSSFIY
SFGGFPLSNSSIELFYQSKWQAIQLKDGDDFIHPFWAGAHLSDKMNGSIYIFGGGLKYND
SQDIYDYNADNRQLSKLKITLPKEDRFFYNSQKIVLGEDKFITMGRHGVYKMDLQRKTCY
KLAEDKVNNQEIKEPLLSKQESKSLKDHRQSSQPDYSNIKIINSSSSSWSPYSQKDKNQE
QTQPQEFKKKPLNPLEIFAQNDRKKTCFRLLQDFFQEPDIPLKDKIILGPVDKYIKYKSQ
NETTRSQERVFYKYFFNEDENYDSLDQGRVRNFYDVNSFREIISNSVENYYTINDRTMEY
YDYFYTDSSMQQIKPVKIQLFYADEQFTPQNYMEGFIEEDSNFLEISRENQKIFDQQKFS
NEQLKRLIVRLDKIELVYHLSSKLLDSRLAKQFPLYQWLIKQEFSFQDRNHMSLRLMITK
ISATDEYAREYWTQYIWIDIGIILLALSSIFFTWKYIYEVAVLYNELKLKFAKSSYSKAY
KEQQKTINKIREKNLRYKNELSMAGSQRGGSVKEDTDENDLSDSDTLGNHQNNPGDMSQK
INPQNQDNYFDQSVATKHILDNKSRLQQDFNLEPMVLWEDLTVNDKIKLFSYWTILSIIG
SFLQIFGSLSNIMSVYNIFEIDRQGGNVELLIGLGCMMAWLGLVRYMEYSEEYSILGRTL
SLSAPNVLKTMISTLPVLMGYTFLGVALFYKSNRFSSATGVLTTLYALMFGDMVYDTFYD
LSFTHFFYSKIYLFSFIFFSICVINSLFISVIEDAYVTAKYTSRLDMFLGRQSSQLPVKP
LLRDREPEGLNIDDDLKLNQLQKQSKKELKSQKVLEQMMEQSQIQYDQNMSSRQIHKEHQ
HQYPPGLSQILKRSLTSHHFPYQRQFSQFKNDDESQKEFNKKKLQLNLEFKEAIDRMENV
INYTGEIMHMYRTNEISEQQYRQFNLEMDSKIVQMQNMLIQLEEKSKNT