Identifiers and Description

Gene Model Identifier

Contig19180.0.g19

Standard Name

KELCH22

Aliases

Contig19180_0_g19

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008234109.997093137033517e-262Ser/Thr protein phosphatase fa
mily protein
SGDYER133W1.9992362000979228e-56GLC7 SGDID:S000000935, Chr V f
rom 432495-432671,433197-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19180.0.g19(coding)
ATGGCTCAAAGATAACAGCCTGCAAAGAAATCAGGCACTGCAAACTCACAAATGGGAGGT
GGGGCTCCTCAATAGCAACAACCACTCTCTACTACTCTCGGTCAGCAACCTAGATCTGCT
GGTGGCTAATAATAGACTCAAATGCAAGATATCGAGTAAATTCAACCATAAGCCTTGGGT
GGAGTTGCCGCTGGAAATACCTCCGGTCAAGTTGAAGAACTAGATGTTTATGGAGAAATT
CCTCAAGCTCGTTTTGGGCACACTATCACTCTAGTCAGTAAAACTAAAGTGGTGTTATTT
GGAGGAGCAACTGGAGACACTGGAAAATATTCCATGACTGGAGAGACCTATCTTTTCAAC
ATTTTAACAAAAACATGGCAAAAACTCAATGTAAAGGGAGTTCCCCCTTCTCCAAGAGCA
GCTCATTCTTCAACAAACGTTGAGCAGATGCAAATGGTTGTGTATGGTGGTGCTACAGGA
GGTGGAAGTTTGGCTTCTGATGATTTATATTTGCTTGATATGAGAAACGGCGATGATATG
GCTCAGTGGATGATTGTGCCTGTTGTAGGATCAACTCCAGGTCGCAGATATGGACACACA
ATTATCTTCTCTAAACCTCATCTATTAGTGTTTGGAGGAAATACTGGTCAAGAAGCTGTG
AACGATGTATGGTGTCTGAGTGTTGAGAAGGCTCCATTTTCTTGGATAAAATTAGATTGT
GGCAAGGAGAATCCTGCTGTTAGAGTTTATCACTCTGCTGCACTTTGCCAAACAGGTAGT
GCTACAGGTATGATGGTTGTCTTTGGTGGTAGAACATCAGATCAAAGCTCTTTGAACGAT
AGTTGGGGACTTAGAAGACACAGAGACGGTAGATGGGATTGGGTCAAAGCACCTTACAAA
GCCACTGGTGAACAGCCAACTCCTAGATATCAACACTCAACATTATTCTTGGGACCCTTA
ATGATGGTCATTGGAGGAAGAACAAATCAAGTAGGTGAAATTGTGCCCCTCGAAGTTTAT
GACACAGAATCATCTGAGTGGTATAAGTTCAACTCACTTCAAAGATTCAGACATGCATGC
TGGTCGGTTGATGCTAACGTTTACGTGCATGGTGGATTCGAACATGAAACTCCAAATATT
CCAATCAATATCATTGCCAGAATTGACTCATATAAGCTATTCCACAAACACGAGCACTTA
GTCTCAAAGATTAAGCCAATCGAAAGTAAGGGCAAAGAAAAGGGAGCAGGAAAAGACGGT
ATTAAGAAAAATGTAGGACCAAACATTGGGAATATGGGTCAAGAACGTGAATTCAGATTG
TCAAATCAAGCACATATCGCTATGAGTTATGCTGGTTAGGGCGAAGCTCCAGTTGAAGAC
TTCTCTATGCTCGTTAGACAGATCTCTATTGATAAACTTTAGGAAGAGCCCAAGAAGCTT
GGTCCAGGTTTCAAGAATCAAATGTCTTAAAATAAGAATCCTCATGAAGCTCTCTACAGA
CACTTCCTGATAAGCTTGTTGAAGCCAAAGGACTTCACTCTTGCTCCATGGGGCTCTAAG
TTCCCATTAAAGAGAGAGGATATTATAGAGTTGGCAACTGAATGCATTAATATTCTTGCT
ATTCAGCCAACAGTTATCAAGGATCTAAAGCCACCCACTAAGATCTTTGGAAACCTTCAT
GGTAATTATGCTGATTTGATGAGATTCTTTGACATCTGGAAAGCACCATCAGATAATAAT
GGTGATATTCATGGATTTGATTATGTCTTCCTTGGAAATTACGTCGATAGAGGTGCTTAC
AATCTTGAGACTATCTGCTTATTGATGGCTTTGAAACTCAAATATCCCAGACAAATCTTT
TTGTTGAGAGGAAATCATGAAGACAAGAATGTAAATAGATATCTCGGATTTGGAGAAGAA
TGCACCAAGAGACTCGGAGAAGATATTAACATGTCCAACAGTGCATTCGCAAAGATCAAC
GAAATGTTTGAATACTTGCCACTTGCAGCAGTGGTTCATGACAAAAGCACTTCAAATAAG
GTGTTCTTAGTTCATGGTGGTATCGGATCTACAGCCATGAAAGTTGAGGAAATTGAGAAG
ATTCAAAGACCAATCCAAATCAATCTTGGTGAGATTGCTACTCAAGAACAATAATTAGTC
GTAGATTTACTTTGGAGTGATCCTACTGATAGCGAAGAAGAAATGGGTATCGTACCAAAC
TTAATCAGAGACCCACTTGGTTAAAATAACATCATGAAATTCGGTCCAGACAGAGTAGAG
AAGTTCCTCAAAACTAACGGCATGAGCATGATTCTTAGATCCCATTAAGTTTGCCCTGAC
GGTATCGATAGATTTGCAAATGGCTAGTGCATTACTATTAACTCATGCACGGACTACTGC
AATAAATATGGCAACGATGCAAGTTTCATTATTTTGCAAAAGAAAATCATTGTCTCTACA
AAGATTATCAAACCTACTCAGAACTCCAAGGTCAATTGGATTGAAATCGGACCGACACCA
GATGCTGCTAATTCAAGTGTCAAAAGACCTCTTACTCCAATGAGAGTCACCAAGGCTGCT
AGCTGA


>Contig19180.0.g19(protein)
MAQRQQPAKKSGTANSQMGGGAPQQQQPLSTTLGQQPRSAGGQQQTQMQDIEQIQPQALG
GVAAGNTSGQVEELDVYGEIPQARFGHTITLVSKTKVVLFGGATGDTGKYSMTGETYLFN
ILTKTWQKLNVKGVPPSPRAAHSSTNVEQMQMVVYGGATGGGSLASDDLYLLDMRNGDDM
AQWMIVPVVGSTPGRRYGHTIIFSKPHLLVFGGNTGQEAVNDVWCLSVEKAPFSWIKLDC
GKENPAVRVYHSAALCQTGSATGMMVVFGGRTSDQSSLNDSWGLRRHRDGRWDWVKAPYK
ATGEQPTPRYQHSTLFLGPLMMVIGGRTNQVGEIVPLEVYDTESSEWYKFNSLQRFRHAC
WSVDANVYVHGGFEHETPNIPINIIARIDSYKLFHKHEHLVSKIKPIESKGKEKGAGKDG
IKKNVGPNIGNMGQEREFRLSNQAHIAMSYAGQGEAPVEDFSMLVRQISIDKLQEEPKKL
GPGFKNQMSQNKNPHEALYRHFLISLLKPKDFTLAPWGSKFPLKREDIIELATECINILA
IQPTVIKDLKPPTKIFGNLHGNYADLMRFFDIWKAPSDNNGDIHGFDYVFLGNYVDRGAY
NLETICLLMALKLKYPRQIFLLRGNHEDKNVNRYLGFGEECTKRLGEDINMSNSAFAKIN
EMFEYLPLAAVVHDKSTSNKVFLVHGGIGSTAMKVEEIEKIQRPIQINLGEIATQEQQLV
VDLLWSDPTDSEEEMGIVPNLIRDPLGQNNIMKFGPDRVEKFLKTNGMSMILRSHQVCPD
GIDRFANGQCITINSCTDYCNKYGNDASFIILQKKIIVSTKIIKPTQNSKVNWIEIGPTP
DAANSSVKRPLTPMRVTKAAS