Identifiers and Description

Gene Model Identifier

Contig10910.0.g97

Standard Name

KELCH21

Aliases

Contig10910_0_g97

Description

Calcineurin-like phosphoesterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006230609.997093137033517e-262Ser/Thr protein phosphatase fa
mily protein
SGDYER133W1.0002012508493003e-67GLC7 SGDID:S000000935, Chr V f
rom 432495-432671,433197-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10910.0.g97(coding)
ATGTAGAAAGTTGAGGTTTTTGGAGAAGTTCCTCTCGCAAGATTTGGACACACTATCACA
CAAGTGTCTAAATCTAAGGTGGTGCTCTTTGGTGGTGCTACTGGAGATACTGGAAAATAT
ATCATTACAGGCGATACCTATGCCTTGGATTTGATTTCATATAAATGGACCAAACTTGAA
GGATCTGGAATTGCACCAAGCCCTAGAGCTGCTCATGGAAGTTGCTCAGTTGATTAATTG
CAAATGGTCATCTACGGTGGCGCAACAGGCGGTGGTAGCTTGGCCTCAGATGATTTGTAC
TTATTAGACTTGCGTAACGGTGACTAAGCTGCTCAATGGATGATAGTACCAATTGTGGGT
TAAACCCCAGGACGTCGTTATGGTCACACTATAGTATTTTCAAAACCATTTTTGCTTGTA
TTCGCAGGAAACACAGGTACCGAGGCTGTGAACGATGTATGGTGCTTGAATGTCGACAAA
GCACCCTTTTCATGGACTAAACTCGAAACACCAGGTGAAGCTCCAATAGTCAGAGTCTAT
CATTCTGCAGCATTATGTCAGACTGGATCGGCCACTGGTATGATGGTTATCTTTGGCGGC
AGAACTGCCGATCAGAGCGCATTGAAGGATACCTGGGGACTTAGAAGACACAGAGACGGT
AGATGGGACTGGGTTAAAGCTCCATACAAGCCAAACACTGAGGAACCACTTGCTAGATAT
TAACATTCCACAATCTTTGTTGGAACTCTCATGATGGTGCTTGGTGGCAGAACAAACAAC
GTTGGAGAGAATGTGCAACTTGAAGTTTATGAAACAGAATCTTCAGAGTGGAAGAAGTTT
TCTACTTTACAAAGATTCAGACATACAGTTTGGGCAATGGATTCTAATATTTTCATGCAT
GGAGGTTTCGAAAATGAAACTCCAAATATTCCAACAAACACAATTGTGAAGCTAGACTTA
TTAGGACTATTCAAAGGAAATTAAATTCTTTTGGATAAACTTAAGAGTGTTGTTGGCCCT
GGAAATCCTCTTAGCGGCAAGAAGAATGATGGATCTAAAAACGGGGACAAGTCAACTGAC
GATTCTTGGTCAAATGGATCCAAGACTCCCCCTTCAAATGGAAGTAAATCTCCATCTATA
AGATTCGATCCAATTCAAATTTGTGGACCAAATGACTCTAAACCAATGCAGCTATAATTA
GATGAGCTTAATCGCAAGCCTGGTGAAAAGGCATCAAAGGGTGGCCCATCGAAATCTAAC
AACTCTGTAGACACACTCTACTCTCTGTTTTTAAATCATTTGCTAAGACCAAGAGAATGG
AATGCACAGTTCGACGGCAATGGGTATTTCGCATTTAGAAGAGAGCATATTATTGCGCTT
GCTGAAGAATGCCAAAAAATCTTGGAGGACCAGCCTATGGTCTTGAGAGTAGATGCTCCG
ATCAAGGTCTTTGGTGATATTCATGGATAATATCAGGATTTGATGAGATTCTTCGATTTG
TGGAGCACACCCTCTGAGACTGGTGATATTGAATGCTTCGATTATCTGTTTTTAGGAGAT
TATGTTGATAGAGGTTCTCACTCTCTAGAAACTATTTGCCTGTTGATGGCTCTTAAAGTT
AAGTACCCAGACAAGATTCATTTACTAAGAGGAAACCACGAAGATAAATGGATTAATAAC
GCATTTGGTTTTGCTGAAGAGTGCTCTCATAGACTCGGTGAGGACCCAGCTGAACCAGAC
TCCGTTTTTAACAAGATTAATGACTTATTTGACTGGCTTCCTTTAGCAGCAGTCATTGAA
GATAAGATCGTTTGCCTTCATGGTGGTATCGGAAGTACTCTCGTTAATATTGAATAGATT
GAAATGATATAACGGCCATTAGAAGTTATCCATGAGGTCTCAACTCCAGAGCAGTAACTC
GTCGTAGACATTCTTTGGTCAGACCCTACTGATAATGATTAAGAATTAGGAATCCAACCT
AACTTTATTAGAGATCCTAACGGTACAGGAAACATTGTGAAATTCGGACCAGATAGAGTG
AAATAATTCTTAGATAACAATAAGGCTAAGTTTATTTTAAGAGCTCACGAATGTGTTATG
GATGGATTTGAGAGATTTGCTGGTGGTTAACTTTTCACAGTCTTTTCAGCTACTGATTAC
TGTGGTAGACATAAAAATGCAGGTGCTATGTTGCAAATCACAAAGAACTACGAGTTGGTT
CCAAAGATGATCTACCCCTTGAACAACCCAGAACAGAACTGGATAACTGACGAAGAGCCC
TTAAAGAAGAGACCTCCCACCCCACCAAGATGGGCAAACCAAGGACCTAGAAAGTCATCA
TATGATTGA


>Contig10910.0.g97(protein)
MQKVEVFGEVPLARFGHTITQVSKSKVVLFGGATGDTGKYIITGDTYALDLISYKWTKLE
GSGIAPSPRAAHGSCSVDQLQMVIYGGATGGGSLASDDLYLLDLRNGDQAAQWMIVPIVG
QTPGRRYGHTIVFSKPFLLVFAGNTGTEAVNDVWCLNVDKAPFSWTKLETPGEAPIVRVY
HSAALCQTGSATGMMVIFGGRTADQSALKDTWGLRRHRDGRWDWVKAPYKPNTEEPLARY
QHSTIFVGTLMMVLGGRTNNVGENVQLEVYETESSEWKKFSTLQRFRHTVWAMDSNIFMH
GGFENETPNIPTNTIVKLDLLGLFKGNQILLDKLKSVVGPGNPLSGKKNDGSKNGDKSTD
DSWSNGSKTPPSNGSKSPSIRFDPIQICGPNDSKPMQLQLDELNRKPGEKASKGGPSKSN
NSVDTLYSLFLNHLLRPREWNAQFDGNGYFAFRREHIIALAEECQKILEDQPMVLRVDAP
IKVFGDIHGQYQDLMRFFDLWSTPSETGDIECFDYLFLGDYVDRGSHSLETICLLMALKV
KYPDKIHLLRGNHEDKWINNAFGFAEECSHRLGEDPAEPDSVFNKINDLFDWLPLAAVIE
DKIVCLHGGIGSTLVNIEQIEMIQRPLEVIHEVSTPEQQLVVDILWSDPTDNDQELGIQP
NFIRDPNGTGNIVKFGPDRVKQFLDNNKAKFILRAHECVMDGFERFAGGQLFTVFSATDY
CGRHKNAGAMLQITKNYELVPKMIYPLNNPEQNWITDEEPLKKRPPTPPRWANQGPRKSS
YD