Identifiers and Description

Gene Model Identifier

Contig1413.1.g89

Standard Name

KELCH20

Aliases

Contig1413_1_g89

Description

AMP-binding enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006956509.997093137033517e-262AMP-binding enzyme family prot
ein
SGDYLR153C3.001349705199738e-130ACS2 SGDID:S000004143, Chr XII
from 447575-445524, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1413.1.g89(coding)
ATGGTCCTACTCCCTGCCCTGAGTTTGCATGCATGCGTTGCTTTTGAAAATAACATCTAT
ATATTTGGAGGGTACGATGGGGTGAATCGTAGGAACGACTTTTACAAGTATAACGTGGAG
ACAAATACTTGGATCTAAATTGTGAATGAAGATACTCCTCCCTCTCCGAGAGATAGACAT
ATTGCAGTTGTGCATAACAGATCCATATTTATTTTTGGGGGCTATGATGGATTTAACAGA
GTGAATGATTTCTTCGAATACAACGTCGATGATAATTCCTGGGAAGAAGTTATTAACTCG
GGTAACACTCAGGCACCAACCCCAAGACATTCTCATTCAGCGGTAGTTTATGAAGATTCA
ATGTATGTTTTTGGGGGGTACGATGGCCACTACAGAAACGACTTCTATCGCTATAATTTT
GTGACTAGGGACTGGTCTCAAATCAATCTAAAGCCAAATGGAAATAGTGTCTGGCCGAAG
AGTAGGTACAGAACTAGTACTACTGTCTATAAAGATATGATGTTCTTATTTGGGGGACAT
GATGGAGCAAGGCAATTAAATGACTTTTATTGCTTTAATTTTACAACTGAAATGTGGACA
CTAGTGGAATCAGAAACAAACCTGACTCCATCCCCAAGAGACTCACATATCCTAGTGAAT
TCGGGAAATTCAATATTTCTATTTGGAGGGTCAACTGGTAACCCAAGGTCAGACTTCTAT
GAATTTAAGATTGATGAATCGAAGTGGATCGCAGTCAATCATAAAGGTGGTAAACCGCCC
ACTTCTAGGTTTTGTCATGTTGGCGTTGTTCTAAAGAAGAAGTTCTACATTTTTGGAGGT
TATGATGGAGACTAAAGATTGAATGATTTTCACTATTTCTTAATTGATGATAGAACTTTA
GAAATTCCAGCAGGCACATTAATATCAGATCTGGACTAACTTGTAATGAATCCTAAATTC
TCAGATGTAACTTTCTTACTTGAGGGCAATAAAGAATTCCCTTGCCATAAACTAATACTA
TAAAGATGCCCTTACTTTGCAGCTATGTTTAATATGGATATGAGAGAGAAAACTATGGAT
AAAATTAGAATTGAAAATATCTCATTTCATATCTTTTTATTGATAATACGATATCTCTAC
ACAGATGACTGCGATATCACTTTAGAAAACTCAATGGAGTTATTTGAAGCAGCAGACTAA
TTGGGGATAGATCGCTTGAAACAAATGTGTGAGCAGACTATAATGTCCAATTTAGATATA
GAAAACGCTGCAGCAATCTTTCATGCCTCAGACATGCATAATGCAGCAAGTTTACGGGAA
ATGGCTATGAATTTTATACTCTAAAATTTTGATTAAGTTAGCAAAACTCAGGGTTTTGAC
CAACTTGCAAGGGCCAACGTAGATCTGGTGCTAGAAATTATCAAGAGTCGAAAAGAACCA
CTAGAATAACCATTAGTTCATCCAGAACACAAGTATATCAGATACACTCAAAATAATGAA
TTCGTTAACGAACATTACGAGAAATTGTATTAGAAATCTACTGAAGATTAAAAAGGCTAT
TTTAATGATCTTGCTTAAGATGTCGCATGGTTCAAGCCATACACTCAGGTTCTTGATGAA
TCAAAGCCACCTCTATACAAATGGTATCCCGATGGTCTGATAAACATTTGTCACAATGCA
GTAGATCGCCACGTAGAGTCTGGGCATGGTGACATCCCAGCTTTCATCTATGATTCAGTT
TATACAAACATTCAGGAAAAGATTACCTATAGAGAGTTGCAGAATAGAGTAGGTAGAATT
GCGAATATTATGAGAAAGCAGTTTGGCGTAGAGAAAGGAGATAGAGTTTTACTTTACATG
CCAATGATTCCAGTGAGTGCTTATTTCATGTTGGCATGCGCAAGACTAGGTGCTATTCAT
TCAGTAGTATTCGGTGGTTTCGCTGCTGTAGAACTCGCAAATAGAATCGATGATTGTCAA
CCAAAGCTAATAATCACTGCTTCATGCGGCCTTGAACCAGGAAAAGTCATAAAGTATAGA
CCAATAGTAGATGAAGCCTTGACTCACTGCAAGAAAGTAGAAAACGCCAGTGAATCAATC
AAGAGAATCATTGTCCAGAGGAGGGATCAGCATGAAGAAAAGGATCTTGACAAGAGTCAA
TACTTCGATTACGATGAGCTAATGGAAGGGGAATAGGAACTATCGGAGTGTGTCCCAGTT
GAATCAACTCATCCACTCTATATCCTATATACCTCTGGAACAACAGGTGCTCCAAAAGGA
GTTGTCAGAGACACAGGCGGGACTGTAGTTGCTTTAAACTGGTGCATGAAGAACGTCTTC
AATATCCACAAAGGCGACGTCTTTTTCTCATCTAGTGATATTGGATGGGTTGTAGGACAC
TCATTCATTATTTATGGGCCTTTGATTAGAGGAGCCACGAGTATATTCTTTGAGGGTAAG
CCAGTCATTCCCGATGCAGGAGTGCTTTGGAGAATTGTAGAACAATACAAAGTTAAGCAG
CTCTATGTTGCCCCAACTGCAGTGAGAATTGTTAAGAAAGAAGACTACGAAGGCAAACTA
GTGACGAAATACGATTTATCTTCACTCCAAGGTTTCCACTTGGTTGGTGAAAGATGCGAC
CCAGATACTATCTGGTGGATTCATCACCACTTGCCTCATGTGATAATTAACGATAATTGG
TGGTAGACTGAGACTGGATGGCCCATAAGTGCAAACTTCTTGAACTTAGACGATTTTAAG
ACTGTGTTCCCCACACTGCCAGGAAGTGTAACCAAGCCATGCCCAGGTTATGACGTGAGA
ATTGTAGATGATCACAATGAATTCATCACTGAACCAGAAGTATTAGGGAGAGTTGCCATT
AAGCTTCCTATGCCTCCTTCTTTCATGTTAACTCTGTGGGGTAATGATGAGGCATTTATC
CAGAAGTATCTCTCTGACACTCCAGGCTTCTACACAACAGGCGATGCTGGCATGATTGAT
GAGCACGGCTACCTCCATATCATGACCCGTGTTGATGATGTTATTAACACAGCAGGTCAC
AGACTATCAACTGGTTAATTGGAGGAAGTAATTAATGACCATCCAAGCGTAGTAGAGAGC
GCAGTCGTTGGGCATGTCGATGAAATTAGAGGGGATTGCCCAGTCGCATTCGTCATTTTG
AAGGGCACAAACGAGGACTTCGAATTGTTGAGTGAGGAGGTGAAAGCTAAACTTCAAAGA
GAAATTAACGAGAAAGTTAGGCATGATGTTGGTCCAATCGCCAGACTTGAAGGTGTTATC
TTTGTCTTAAAGTTGCCAAAGACAAGATCAGGCAAGATTCTAAGAGGCACAATCAAGAAG
ATCATAAATAACTAGGAGTTCAAGACACCAGCAACAATTGATGATGCCAGCGTACTTGAC
AACATCAAAGACCTAGCTCAATAATGGCTTGATGCCAAGAGTTAAGCGCTATAAGCTGCT
GCTCAAAAGCAATGA


>Contig1413.1.g89(protein)
MVLLPALSLHACVAFENNIYIFGGYDGVNRRNDFYKYNVETNTWIQIVNEDTPPSPRDRH
IAVVHNRSIFIFGGYDGFNRVNDFFEYNVDDNSWEEVINSGNTQAPTPRHSHSAVVYEDS
MYVFGGYDGHYRNDFYRYNFVTRDWSQINLKPNGNSVWPKSRYRTSTTVYKDMMFLFGGH
DGARQLNDFYCFNFTTEMWTLVESETNLTPSPRDSHILVNSGNSIFLFGGSTGNPRSDFY
EFKIDESKWIAVNHKGGKPPTSRFCHVGVVLKKKFYIFGGYDGDQRLNDFHYFLIDDRTL
EIPAGTLISDLDQLVMNPKFSDVTFLLEGNKEFPCHKLILQRCPYFAAMFNMDMREKTMD
KIRIENISFHIFLLIIRYLYTDDCDITLENSMELFEAADQLGIDRLKQMCEQTIMSNLDI
ENAAAIFHASDMHNAASLREMAMNFILQNFDQVSKTQGFDQLARANVDLVLEIIKSRKEP
LEQPLVHPEHKYIRYTQNNEFVNEHYEKLYQKSTEDQKGYFNDLAQDVAWFKPYTQVLDE
SKPPLYKWYPDGLINICHNAVDRHVESGHGDIPAFIYDSVYTNIQEKITYRELQNRVGRI
ANIMRKQFGVEKGDRVLLYMPMIPVSAYFMLACARLGAIHSVVFGGFAAVELANRIDDCQ
PKLIITASCGLEPGKVIKYRPIVDEALTHCKKVENASESIKRIIVQRRDQHEEKDLDKSQ
YFDYDELMEGEQELSECVPVESTHPLYILYTSGTTGAPKGVVRDTGGTVVALNWCMKNVF
NIHKGDVFFSSSDIGWVVGHSFIIYGPLIRGATSIFFEGKPVIPDAGVLWRIVEQYKVKQ
LYVAPTAVRIVKKEDYEGKLVTKYDLSSLQGFHLVGERCDPDTIWWIHHHLPHVIINDNW
WQTETGWPISANFLNLDDFKTVFPTLPGSVTKPCPGYDVRIVDDHNEFITEPEVLGRVAI
KLPMPPSFMLTLWGNDEAFIQKYLSDTPGFYTTGDAGMIDEHGYLHIMTRVDDVINTAGH
RLSTGQLEEVINDHPSVVESAVVGHVDEIRGDCPVAFVILKGTNEDFELLSEEVKAKLQR
EINEKVRHDVGPIARLEGVIFVLKLPKTRSGKILRGTIKKIINNQEFKTPATIDDASVLD
NIKDLAQQWLDAKSQALQAAAQKQ