Identifiers and Description

Gene Model Identifier

Contig18596.0.g10

Standard Name

KELCH137

Aliases

Contig18596_0_g10

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000669107.000255027549774e-17Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18596.0.g10(coding)
ATGGACTTAAACTTGGAAAATACTTGTATTATTTGCGATGAAAGTTTCAATCTCAAAACC
AAATCCCCTTATCTACTGCCTTGTAAAGAACATACAGCCTGTAAATTATGCTTGAGTGAG
GCCAAAGACAGCGGTGAGACAGAGCTGCTCTGTCCAATAGACAGCACCTCTCTAAAGCTC
TCCCAACTGAAATCCCTGTCTAAAAATATGTAAATTGTCGCTTTCCTCAAGAAATAGAAG
CCGCAGTCAATTAGCCAATCACTGTAAAGTTCAATATCATATTTACCTGGTAATAATAAT
GGGTTAGTAAATAATAATGCAGGGATTAAGGAATCTAAATGGCTCTAGGAAGTCAGTGTG
ATTAGTGGGGTTTAGCAAAGTGACTAGAGCTCGTTTATTCAATAAAATTAAAGCAAGATA
GAAGAGGAGGAAGATCTTAACAAATCTGATTCAGCTGTCCTTGACATCTCCAATGCCAAT
ATTTCCAAGAGAAGTAAGAAGAAGAAGAAAAAGAAGAAGAGAAAAGGTGACAACTCATTA
CTTCAGTCTATGCTTTAAGACCCCAAGAATTTTCTCGATTAAACTGGCCTCAATCCAATC
ATGGAAGAATCCAACGATATATCTCCTGGAACCACAAAATCACATAACGCCATAAGCCTC
GGATAAACTTAGAATTAACAGGCATTCCAGAAAATTCAGATAAATAATGTTACTTAATCT
ATTCATGTACAGAAAAATTAAAATTAAAATGAAGCAAGCAAGTATGATATTAACATAAAC
TAAGCTTCGATGAATTAAGATTTAAACAACTATTAGATTTTAGACTCTTAAAGATCTACC
TCAATTTTTAAGCCTAATCAATCCTAAAATTACAACCCACTCATGACTATGATTTCAGAT
AGACGATTTTCGAATATGTAAATGCAGCAATCTTATAACGGAAACCCACTTCAAAATAAC
ACAACGTCTTAAAATTTACTTCAACCACAGTTAACTATATCAACCAATTAGAATGATAAA
TCTGTAAAAACTTTATAGCCAAATATGGGAATTTAAGTTTAAACCTTCTCTGGTAGTACA
GCTATCAAAAATATGAAGATTGAAGATTAACTAAGAAAATCTTAAGTGGAATTCTCTTCA
AAATCTTCAACTATTAAGCAATCTTCAACATCATAATCTAACCTAATTAAGAATTCTCAG
CAATCTTAGCCTATACAGCCATAACAATAGTTGTAGGAACAGAAATCTGTAAATTAAGTG
ATTTCTTTTTAAGAAAATTACACTCCAGCATTTCAAATTCGTGAAGGCGAATGCGCAGAG
CATTTAGGAGAGGACTATCGACATTTATGCTTAGATCATAATAAATTACTTTGTCCAAAA
TGCTTGATAAAGCATAAGACATGTGACTTCAAAACTTCCAATGAAACTTTTGTGTTTGAA
AATAAGCAAAGACTTCGATAGCTGCTTAAAGAGCTGAATAACGATATTCAAAAAACAATC
GCTTAGAAATAGTCAATTGAGATTGCTTAAGAAGAAGTTTTGAATTACAAAGAGCAGAAC
ATTGAAATGATTAATTTTATGTTTAGTTAGCTGTTTATAGAACTAGAGACAAGAAAGTAA
TAGCTTATTGAATAGATAGAAAATGTAGTTAGAGATATAGATTGCAGTTTGAAAAGTGAT
AGAATTGTAATAAGTGATAAAGAGTAGAAATAGAATGGATGGCTTAATTTGACCAAGGAA
ATTTAAAGGAAAATATATGAAGATTAAGAGTAGAACAGAGAAAACATAAGAGTATTGATC
GAATGGGAAAATATTAATAAGTTGGAGACAGATCTATCATAGTTTTAGAATCAAAATTAA
AATAAGTTCTTAGCAAGCTAAGTCTACGAAACACCCAGAAGCACCTTCAAACTCGATTTA
GGTAAATTCAATAAACAAGTTAATTAGCTTCAATAATAACCAGATAGACCTACTTCCAAT
ATGAGGACAGCTTAAAAGAAAATTATTTGGTTTAAATGGGGTTCCTACGAGGCTTTTAAG
TTTGACGCAAAGAATGATAGATGGAATAAAATTGAAGCCAAACCTATAAATCCATACCTT
TACTTTTCTTCAATTGTTCATTTGACAAATTAAAGAGGAGCTTTAATGATAGGAGGCTCA
GATGAAGATGCAAATTACTACAGAAGAGTAGTTCATTTTGAAAATTATCAAATATTTAAA
GACAAAGCCCCCATGATTAGCAAACGAGCATTCTTTTGTAGTTTGCATTGCTAATGTACA
GATTAAGTTTTTGCTTTTGGAGGGAATGATGGAGAGAAAGATTTAAAATAGGTTGAGCTC
TATGATATGGAGTATAATAACTGGGTTGAGTTGCCATCTATGTAATAAGCTAGAAATGGG
GCAAGTTGCGTTATATTTGAGAAATACAGGACTATATTCTTATTTGGAGGAGCAAACATT
GAGAATGGATCACTAGACTCTATAGAGAAATTTTCGATGCAGACTTAAGTCTGGGAAATT
ATAAACATTAAATTAGTAAAACCATTGCATGATTTTGTTTGCCATTCTATTGGTAAAAAT
AGAATCCTTATTCTTGGGTAGCCTGATCCTGTATAATAAAATCCAGATCAAGAAGATTTA
CAGTAATCTTAGAGAGCTGTTGAACAAGATGTTGAACTTTAAATTATCGACCTTTCATAC
CATTTATAAAACTAATGCTCAGTACCTAAATCAATGGGTCAGACCTACCTTCCAACATTT
CTAGATGCTTGTGGGTTCTTATACATTTTTACTGGATACCTTGATAATAAACCTACACAA
ACTATATCAAATATAAAATCCTTGATCCAGCTATAGTCTGTCAATATGCAGGAACTTTTT
GATAAATAAAAACGGTAATTGTAATAGTAATGA


>Contig18596.0.g10(protein)
MDLNLENTCIICDESFNLKTKSPYLLPCKEHTACKLCLSEAKDSGETELLCPIDSTSLKL
SQLKSLSKNMQIVAFLKKQKPQSISQSLQSSISYLPGNNNGLVNNNAGIKESKWLQEVSV
ISGVQQSDQSSFIQQNQSKIEEEEDLNKSDSAVLDISNANISKRSKKKKKKKKRKGDNSL
LQSMLQDPKNFLDQTGLNPIMEESNDISPGTTKSHNAISLGQTQNQQAFQKIQINNVTQS
IHVQKNQNQNEASKYDININQASMNQDLNNYQILDSQRSTSIFKPNQSQNYNPLMTMISD
RRFSNMQMQQSYNGNPLQNNTTSQNLLQPQLTISTNQNDKSVKTLQPNMGIQVQTFSGST
AIKNMKIEDQLRKSQVEFSSKSSTIKQSSTSQSNLIKNSQQSQPIQPQQQLQEQKSVNQV
ISFQENYTPAFQIREGECAEHLGEDYRHLCLDHNKLLCPKCLIKHKTCDFKTSNETFVFE
NKQRLRQLLKELNNDIQKTIAQKQSIEIAQEEVLNYKEQNIEMINFMFSQLFIELETRKQ
QLIEQIENVVRDIDCSLKSDRIVISDKEQKQNGWLNLTKEIQRKIYEDQEQNRENIRVLI
EWENINKLETDLSQFQNQNQNKFLASQVYETPRSTFKLDLGKFNKQVNQLQQQPDRPTSN
MRTAQKKIIWFKWGSYEAFKFDAKNDRWNKIEAKPINPYLYFSSIVHLTNQRGALMIGGS
DEDANYYRRVVHFENYQIFKDKAPMISKRAFFCSLHCQCTDQVFAFGGNDGEKDLKQVEL
YDMEYNNWVELPSMQQARNGASCVIFEKYRTIFLFGGANIENGSLDSIEKFSMQTQVWEI
INIKLVKPLHDFVCHSIGKNRILILGQPDPVQQNPDQEDLQQSQRAVEQDVELQIIDLSY
HLQNQCSVPKSMGQTYLPTFLDACGFLYIFTGYLDNKPTQTISNIKSLIQLQSVNMQELF
DKQKRQLQQQ