Identifiers and Description

Gene Model Identifier

Contig19893.0.g64

Standard Name

KELCH135

Aliases

Contig19893_0_g64

Description

Domain of unknown function (DUF4407)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19893.0.g64(coding)
ATGGGCATGAATAACAACGAACTGAAGACCTACAAAGACCGTAATGAGCATAAATTGGAG
GACAAGCAGGTCAAGACTGAAGCTGAAAAGGCAGAGGATAAGCTGAAACAAGCCAAGGAA
GAGTATGATTTCGAAAATGCTCAAATAGAGGATTTGGGCAATTTCATCATCAAGGGCACC
ACTGAGGATGATGGAGTGGGTGGTGGTCAGGTTAATGCTCTTGGAGGACAAGAGGAACAG
GATAAATTAATGAGTATTTTACAGAAGAGAATCGCCAAATTGGATGAGGAATTGGAGTAA
TAAACTAAGAAAGATTAGGAGAAATAGACTGATGTTGTTAATGATGGTGGGAAGGTATAT
GTGGTTGGTGGTGGTAATGCTGGTGTGATTGCCTATGATGAAGATGTTGTTGATGGTACT
AAAGAGAAGAAAATGCCAGTGTTTATTAAGAAAAGAGATAGGAAAACCATTGATAAAAAG
CAGGAATAACAAGAGAAGGATGATAAATAATGCAATCCATTAAATTATAAAAATGAGATC
GGTAAGAAAAATAATAATAGCAAAGTATTGTTATCATTTGATGATGAAGAGGAGTTTTGA


>Contig19893.0.g64(protein)
MGMNNNELKTYKDRNEHKLEDKQVKTEAEKAEDKLKQAKEEYDFENAQIEDLGNFIIKGT
TEDDGVGGGQVNALGGQEEQDKLMSILQKRIAKLDEELEQQTKKDQEKQTDVVNDGGKVY
VVGGGNAGVIAYDEDVVDGTKEKKMPVFIKKRDRKTIDKKQEQQEKDDKQCNPLNYKNEI
GKKNNNSKVLLSFDDEEEF