Identifiers and Description

Gene Model Identifier

Contig17147.0.g22

Standard Name

KELCH132

Aliases

Contig17147_0_g22

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17147.0.g22(coding)
ATGTAGCATTACTAATAGCAACCTCAATCATTCTACTTTTAAGTTAGTGATTCACAAGCT
CTTGATTCGTTTTATTCGAGTGATTCTTTAAGGAGGAAGGATGAAACTTAATCCATTGAG
TATCCACCTGTTTAGACCAACGCATTTCAAATCTACGACACTTGTAAGTATCATGCAAAC
TAGAATATCATAACCAGAGACTATTTCATCAATATTGGATCTTAAATTTTTCAACATTTA
GGTTTAAAGATGCAGGAAGACATTGATTTAGTGAAACAGCACTTGAGCTATTAACAAGAT
TCTTTACTACAAAATTAAACACTTTTGATATCAGACTATTAACGCCTCCTGAAGTATGAG
CGTAAAGAGCTAGAGAAGATAGACGATCACTTCAATCGCATACAAGCCACAGTCACGAAA
CTTAGGTAAGAGCAAAAGTAGAAAATGCGCTAAATGATGGAAAGTTATAAAAGCTAATAT
GAAAGTCGACTTTAACTAGTTTAGAAGTAATCAGAACGCATTGAAAGCTATTTTAAGAAA
ATGTAAGAAGTGGAGGACTAGGTGAGGTACTCTAGAGATCTTAGATAGACAATGATGCTT
ATAGAAAGAGTCACAAGGAAGATTTAGGAGCAGCTTAGTAAAAATGAAAATGGAAGTGAT
TTTTAATTAGAAATGTAAGATGTAATTGAGAAATATAAAATTTAGAAAGTGGTCTTTGAA
ACTAATGACATTGACAATAAAACCATCGATGATGCTATTGCCAAATTAGTTGGACAACTC
TATGTTGTCAATCCTGTTGAAAAATTCTTCTCTTTAACTAAAGATTCTGTCCTTCTCCTA
GATCCTCATAAAAAATCCCTAACTTCAAGCTTCATGGATCTCATGCTAAAGAGTGAACTA
AATTACACATTTTTAATACGGGAAATAAGAAAGACTTGCATCATTTCATTGTCAAATACT
TCCCTAATTGGTTACTATGATCAAACTTCTTTCTTTGAACATGATACTGAGAATCTTAAC
ACTTTGGATAGAGCTGTATGCATGAACACCCTACGAAAGAATTTCTCAACTTGCTACAAT
TACCTGAAGTATCCCAGTGACAGATCAGAACATTTATCCATTTATGTTTTAGGAGGCTAA
GATCTTAAAAATTATCAACTTACTTCCTCTATTGAGAGACTTGACTTTTCAGATCCCTAA
GATCTTTAATGGTAACTAGTTGGCAATTTGTAGATTCCAAGGATAAATGCGCACTCTATA
ATTCTCCAAAACAAGCACCTCTATGTTTTTGGGGGTCTAGGCAAGCTTCTAAACAAGGGT
GCAAAGCTAGTCGAGATAAATGAGATTGAGCGTTTGACTCTTCAAAATGACATGACTGCA
AAACTAAGTCAGAGTTAAATCTTGACTTTAAGACTGCAAGATTCGATTGTGAGAGGCATT
AACTCAGTGTATAGTATCGACGAACAAGGAGGGTTAGTTATAGTATCAAAGGAGTATTAA
GAGAAAGTGCTCGGTAGTACTAATGAGAGAGGCACGCTTAAAGTTCATTGTTTCAAGATG
AATCAGGAAGATTTTGGTATTGAGAGAATAGCTGAGAACGATATCTTTAAAGAGACAGAT
ACTTCCTCTAGCCTTAACAACATCTAGATTCTGCAATCATAATACTTCAAAGACAAATTC
TACCTCTATGACGATTCCAAACCCTTTACTTATAACCCTAAGGATTCCGCAATCGAAATA
TTAACTCTTTCTCAGTAATCTCTCAAATCTCAGTAAATCATCACCTATGAATAAATCTGC
AAAGATGATCTCTAAGAAATGCGATTCTCCTTTGATTTAAGAACTTCTAAGCAAACAGGC
ATCAATCAAATTCTTAGAGATTAATAGAAGAAAAATAATAACGGGATGAGAAATATAGTG
GGAGCAGGTTTGAAGGTTAATAATAGATAAGGTTCTAAATGCGATTTTGAGTTGAAAACT
CTAAAGAAAACTAAACATGGAAAAGAGAACTGA


>Contig17147.0.g22(protein)
MQHYQQQPQSFYFQVSDSQALDSFYSSDSLRRKDETQSIEYPPVQTNAFQIYDTCKYHAN
QNIITRDYFINIGSQIFQHLGLKMQEDIDLVKQHLSYQQDSLLQNQTLLISDYQRLLKYE
RKELEKIDDHFNRIQATVTKLRQEQKQKMRQMMESYKSQYESRLQLVQKQSERIESYFKK
MQEVEDQVRYSRDLRQTMMLIERVTRKIQEQLSKNENGSDFQLEMQDVIEKYKIQKVVFE
TNDIDNKTIDDAIAKLVGQLYVVNPVEKFFSLTKDSVLLLDPHKKSLTSSFMDLMLKSEL
NYTFLIREIRKTCIISLSNTSLIGYYDQTSFFEHDTENLNTLDRAVCMNTLRKNFSTCYN
YLKYPSDRSEHLSIYVLGGQDLKNYQLTSSIERLDFSDPQDLQWQLVGNLQIPRINAHSI
ILQNKHLYVFGGLGKLLNKGAKLVEINEIERLTLQNDMTAKLSQSQILTLRLQDSIVRGI
NSVYSIDEQGGLVIVSKEYQEKVLGSTNERGTLKVHCFKMNQEDFGIERIAENDIFKETD
TSSSLNNIQILQSQYFKDKFYLYDDSKPFTYNPKDSAIEILTLSQQSLKSQQIITYEQIC
KDDLQEMRFSFDLRTSKQTGINQILRDQQKKNNNGMRNIVGAGLKVNNRQGSKCDFELKT
LKKTKHGKEN