Identifiers and Description

Gene Model Identifier

Contig4112.0.g41

Standard Name

KELCH131

Aliases

Contig4112_0_g41

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006846201.999790113608142e-24Kelch motif family protein
SGDYGR238C0.000019995566179747357KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4112.0.g41(coding)
ATGAACATAAGCTTAAATGCTGTGAGATAAGGCAGCAATTAAAAGTAGAAAAATAAAGGT
AAATCTATTATGCATGATAAGGACGATGAAATATTAAGCTAAGACTAATTTAAATCGGAA
ATGTTCAAAATTGAGAGAAAGAAAAACATAGAGACTTATAGTGTTAGTAATTTAGTCAAG
TAGTAGAAACTAAATTAAAAGTAAAAAAGTTACAAGAAAGATACTTATTTAGGTCTTAAC
ATAGTTTCTGGTTAACATAAAAGAGAGTAAAGCAAGGAAACTCTTAATTTTAAATTAGAC
AGGCGAGAACGAGAAGCCCTCAACGATTTCCTATCAGACGAGGACGATCTCAATGACTTC
ACAAATAAATTCAGTCATTAAATAAAGACACCAATCACCCATTAATCAAAATTACTTTAA
TCAAAGTAACAAGAGAAATAGAGGTAAATCATCGTTTTAGCAAATAGTTAACAAAAGCTG
AAAGAGGATTAGAAAACTGATCTTTAGACAATATCCAGACCTTAAACCCGTAGAAGACCT
CATACAGCTTCTAAAAGCAGCACTGCTATTTAAACACAATAAGACTTCAAAAACAAGACT
GGAGACAACTTCAACAAACTATCAACTTAGGTGATTCAACAATTAAATGCTGAAGAATAA
ATGAATACCTAGCAATTGTCTAATCAGGAGCAATTTCTTATACCTATATCGAGAAAATTG
ACTCAGCTTTCAAATAAACCGCCATTGAATTCTTAGAGCAAAACCAATGGAGGACATGCT
TCGAAGTCAATTAATGCTTCTTATTCAGGTGGAAACTCTCCATCAAATAGTGTCATGAGG
AATAAAATTTTAAGAGAATCTAAAGCTGAACTATGCAAGAAGCTTAATGAAGTTGAAAAC
AAAATAAGTGACAGTAGAGAGAGTAGTCTATTAAAAAATAAATTCTGTAAAATCTATGCC
AAAATAAGCACTATGAATATGACTTAAGATGGAAAACTTGTAAAACATACTATTCATAAT
AATGATTTTATTGAAGATTAACCGAATCTATAAGACAATGATAATAATCGAAATAAAAAA
GAAATTTACATGAATCTATCTGCTAAAATAAATAACAAAAACTTAGATAATTTACTAAGC
TCGATGGAGTCCAAATTTAAGAGAATCATGAACAAGAGTAATTCCAAGGATGTAGTAAAT
CGAATGATTGAAGTCATCGACAGTAAACATAAACTTTAAGAAACGGGTACTCTAACCAAT
TTAAAAAGTGATAACACATTTAAACAACTAGATTTGACTTAAATTATCAAAGACTTGGAC
AAAAGTGCGATTATGTAAACTTAAAGAATTTAAGATGATGCAATTAAGAGTCAGCAAAAT
TAACTACCAACAATATCTCTCAGGAGGAATAAACTTGAGGAATTCAGATTACGAGATAAC
TTGGACATTGACAACTTTTTCAAGCTTACTTTTGATCAGAGATTTCAGATAAAAATTAAT
AGCGAGGATTTAAATTTTGCTAAAGAAAAAATAACTTCAAATTTTGTTAAGGCCAACGAT
TAATCCTAATAATTTACATTGAATGAAGAGATTTTACCTTCAACCAGATAAGAAGATATT
ATAATGGGAGTTAAAAGGTTTTAAAAGTCGGGGTTCTGGATTAAAAAACAGGCTCTTGGA
ACATGTCCAGTTAGTAAAGAGAATCCAACTCTTTTCTATATTTAAAATTAGAGACAATTG
TATGTTTCAGGTGGCTACTCAAACTGTTCTTAACTAGAAGTTAATGAGATAGTTCTTTCA
GGGAATCAGTCAAAATGGAGAAAATCCATTCCAAAGCAGCATGTTTAAAATCATTATGGC
TAAGTTATGCATATTTATGAAGAAAAATATACAAAATAGAAAAAGATCATAATGTTTGGA
GGGCAAGCAAGTCTTGAAAAGCAGCAAGGTAAAGCCAAATACTCCTGTTCAGAGTTGAAA
ATACTAGACCTAGATAATCTAGAAATGAATGAGTTTTCACCAACTGGTGATCTTATTTAA
GGCAGGAAAAACATGGGCTCGTGCATAATAGATGGAAAGATGTTCATTCATGGGGGTTAG
GACAATCAATAAGATGCCCTAGGTGATTTCTTTGTCTTTGACGCTTAAACATTCGTTTGG
AAAAAGTTAAAAGTAACTCCCAAAAATTCTGGAAAATATACTGAAAGCATTAACCTGAAA
TTATCTCATCATACAATGACAGCTCTTCATAAACCTTTGCAAGGTATCATAGAAATTTAT
ATATTTGGAGGCCTTGATCATGAACACAAACCTTAAAATAAACTATATTAGCTCTAATAC
AATATACATTCTCAAGAGACATTTATCAAAAGTATGAGCGATTAGAAGGGTATTTCACCA
TCTCCTAGAAGCCATCATACTGCTTTGCTAATTCACAGGAATAAGTATTTGTTGATTTAT
GGCGGTAAAAACGAGGATAATTACCAATCAAATTCTTAAAATTTAAGCTCCAATAGCATA
GCCATAAATGATATCGTGTTATACAACCTTAACACCAAATGCTGGGAGAACTTTGATTAA
TTTGGTTTCAAACCAGAACCTAGATGGAATACTTCCATAGTTTATGACGAACTTTAAGAC
AAATTGATACTTTTTGGTGGTAGCAATTTACAAGGCTTTTGCACTAACCATTTATATATT
CTAGAAATGAAACAAGATACTATTGATATTTTGTGCTAGAGAGTCAATTAATGTCAAATT
TACCTTTAAGATTTGGAAAAGCGCATTTTAAAGCCTAATGAAAATTCAGGGTAGAGCAAC
TTGAATAGTATCAATAAGTCTGTATAAATGAAATAATCGAATGCTTTACTTAGTGCTCAT
AAGAGAGCCGTCAAATTTCTCGATAATCGGTCTGCAAATAAAATCAGGCAATAGAATGAT
GATTTTGATTAATTTTAGCATTAAACAGATGAAAGTAACTTTAATAATACACCAATTAGA
AGATAATTTAATGCAGATATTTAAAATGATGATAATTAAAGACAAAGCTTAACTTAGCAA
TTCAGGCTTGAAAGTTAAACAAGTTTTCAAAAAAGTAAAAGTAGGACTAAAATTAACTAG
AATATGATGGAGACTTTAAATCTATATGCTAAAACAATAACAAAACCTATTTTTGAACTT
GATTGA


>Contig4112.0.g41(protein)
MNISLNAVRQGSNQKQKNKGKSIMHDKDDEILSQDQFKSEMFKIERKKNIETYSVSNLVK
QQKLNQKQKSYKKDTYLGLNIVSGQHKREQSKETLNFKLDRREREALNDFLSDEDDLNDF
TNKFSHQIKTPITHQSKLLQSKQQEKQRQIIVLANSQQKLKEDQKTDLQTISRPQTRRRP
HTASKSSTAIQTQQDFKNKTGDNFNKLSTQVIQQLNAEEQMNTQQLSNQEQFLIPISRKL
TQLSNKPPLNSQSKTNGGHASKSINASYSGGNSPSNSVMRNKILRESKAELCKKLNEVEN
KISDSRESSLLKNKFCKIYAKISTMNMTQDGKLVKHTIHNNDFIEDQPNLQDNDNNRNKK
EIYMNLSAKINNKNLDNLLSSMESKFKRIMNKSNSKDVVNRMIEVIDSKHKLQETGTLTN
LKSDNTFKQLDLTQIIKDLDKSAIMQTQRIQDDAIKSQQNQLPTISLRRNKLEEFRLRDN
LDIDNFFKLTFDQRFQIKINSEDLNFAKEKITSNFVKANDQSQQFTLNEEILPSTRQEDI
IMGVKRFQKSGFWIKKQALGTCPVSKENPTLFYIQNQRQLYVSGGYSNCSQLEVNEIVLS
GNQSKWRKSIPKQHVQNHYGQVMHIYEEKYTKQKKIIMFGGQASLEKQQGKAKYSCSELK
ILDLDNLEMNEFSPTGDLIQGRKNMGSCIIDGKMFIHGGQDNQQDALGDFFVFDAQTFVW
KKLKVTPKNSGKYTESINLKLSHHTMTALHKPLQGIIEIYIFGGLDHEHKPQNKLYQLQY
NIHSQETFIKSMSDQKGISPSPRSHHTALLIHRNKYLLIYGGKNEDNYQSNSQNLSSNSI
AINDIVLYNLNTKCWENFDQFGFKPEPRWNTSIVYDELQDKLILFGGSNLQGFCTNHLYI
LEMKQDTIDILCQRVNQCQIYLQDLEKRILKPNENSGQSNLNSINKSVQMKQSNALLSAH
KRAVKFLDNRSANKIRQQNDDFDQFQHQTDESNFNNTPIRRQFNADIQNDDNQRQSLTQQ
FRLESQTSFQKSKSRTKINQNMMETLNLYAKTITKPIFELD