Identifiers and Description

Gene Model Identifier

Contig22312.0.g7

Standard Name

KELCH124

Aliases

Contig22312_0_g7

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006538000.00000000000009996062864481225Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22312.0.g7(coding)
ATGCCAACAGAGTTGCCAGATGTCATTGACCATTTCCTTTGCAAAATTTGTCGTCTCGTT
GTGTACTAGCCCAAAGAGTGTTCTCGCTGTGCATCCCTCTATTGCTTCGACTGCAGTAAC
AATTTGATTTCCAAGAATAGCAAGTGGTAGTGCGTTGATAAAAAATGCAACTCTCAGGAC
CCTCTGGTTGAAATTCATCGTACTGTCAAAGAAGTCATGGAGAAGCTTGTGTTTTCATGC
CCAAAGTGCGGAGGAAACAAGCGTACTTACAATGAGATGGTGAAGCACATTCCAGTTTGC
GATGGTGCAAATGCTGATTCAGCTTAAGATGTTGTCATTGAGAATATTAGAAAGGCTGAG
ACTCAATAAGCAATTTAGCAACAGATTTAGCCTGCTCAAGCAATACAGTATACAGAGATT
CTGATTCACATCATGGAGAAGGATTCGAAAAAGTTCTACATCTTCAACAGCAGAACTCAA
CAAGTCACAAGCCATGAAGTCAATTGCCTTACTAATTTCCCTCACAATTTCTAAGCAATC
CAGATTGGATTAGTTCAGACTAGAGTTTTCATTGTAGGTGGCGGTGATTTCAACTCAGTC
CCAGAGACCATGTTCCAAATGAATGAAATTGTTAAGAGCGGTCCAAGCTATGCACTCCAA
TAAAAGCAGAAGATGAAGTATCCTCGTCATGGTCACTCTTGCTGCACTCTTGGAGAGACA
TTTATCTTTGTTACAGGCTCAAGAAAGGATACTGACAAAGCCCCAAACAAAACTGAGATG
TACGATACTCGTCAAGATGCCTGGGTTGAGTTAGCTATGTTCAACTAAGGCAGACACTAC
CACTCAAGTTGTTCCTTCCAAAGCAAGTTCGTTTACATTTTCTGCGGTATCTCTAACGAG
ACCAAGAAGTATCTGAACTCAATTGAGAGACTTGAATTTGACCCTAACAGCATTCAGAAT
TCTCTCAAAAAGACCTGGGTTAAATTAGAGATTGCTAACATGGCTCTCTTGTAACCTAGA
CAAGGCTCCGGTGTTTGCTAAGTCAACGATAATGAAATCTTAATCGTTGGAGGTTTCTGT
GGCTAGTTCTCGAACGAAACATTCTTCCTAAACACTCAGACTAACTCTATAAGAAAAGCT
TACAATGAACTTAAAGATAATATATTTCCTTTTCAAGTTCCCACTATTGCAGATCCCCTT
AACCGTTCAGTTTACACTGTCGACTGGTAGACTTACAAATTATATCAATTCAAAAATGAC
TAATGGCAATTCTAGAAGAAAATTAAGATTTGA


>Contig22312.0.g7(protein)
MPTELPDVIDHFLCKICRLVVYQPKECSRCASLYCFDCSNNLISKNSKWQCVDKKCNSQD
PLVEIHRTVKEVMEKLVFSCPKCGGNKRTYNEMVKHIPVCDGANADSAQDVVIENIRKAE
TQQAIQQQIQPAQAIQYTEILIHIMEKDSKKFYIFNSRTQQVTSHEVNCLTNFPHNFQAI
QIGLVQTRVFIVGGGDFNSVPETMFQMNEIVKSGPSYALQQKQKMKYPRHGHSCCTLGET
FIFVTGSRKDTDKAPNKTEMYDTRQDAWVELAMFNQGRHYHSSCSFQSKFVYIFCGISNE
TKKYLNSIERLEFDPNSIQNSLKKTWVKLEIANMALLQPRQGSGVCQVNDNEILIVGGFC
GQFSNETFFLNTQTNSIRKAYNELKDNIFPFQVPTIADPLNRSVYTVDWQTYKLYQFKND
QWQFQKKIKI