Identifiers and Description

Gene Model Identifier

Contig1147.1.g11

Standard Name

KELCH120

Aliases

Contig1147_1_g11

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005321809.002093297142233e-23Kelch motif family protein
SGDYPL263C0.0000009995106777214876KEL3 SGDID:S000006184, Chr XVI
from 46506-44551, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1147.1.g11(coding)
ATGGATATTAATGTCGATGACCATGAAAATCATGATTCTTATTAAAACAACCACTCAAGC
ACTAATAGAAGAAAAGAACTTACTATAAATAGCAACGACTGCATAAATCAAGTATGCGCT
TGGTATGAGTTGTTTATGAGTGGAAAGTTGCCTCATAGAAGAGCTTATCACGTATCCTTT
TATTGGAATGATCATTTCTATGTACATGGTGGGTAAGATTTGAAGGAAGGAGCCTATGGG
GACCTCTGGAGAGTGGATTATCAATTTATTTTCAACGAGACTTAACTTATTAACGATAAT
CAAATCTAGAATATAGAATGGGAAGAAATTTAACTATCTGGCGTATATCCCAAGAAGTTA
TCCCATCATGCAGGTATTCTACAACCTGCACTTTAATCATACATCATATACGGAGGCATA
GTAGGAGCTGATAGCAGTGATGTACTGTATGTGATTAATCTCAATAATTTCAATGTTCAA
GCAATTCCATCCAACCAGTAAACTGAAAAAAATGGAAAATCTCTGCCAGGACCTAGAGAC
GACTTTTGGGGATATAAGAATGGATAGAAAATGAATGATATTTTCAAACTGCATATTTTA
GATCGTGGCAGATAATTTGTCTGGGAATTACTAGAAATTTAAGGGAAATCATGTCCACAA
CCACGGTCAGGATTCTCAGGAGTCTGTCTTCATGATAGTTAGGGGAATGAAGAAGTTTAC
ATCATTGGTGGAGCAGGTGACAACAGTAATAGATTTAACGATTTATGGAAATATGAAAAT
CACAAATGGACTTTGATTGCCACAGATGGTTAAGATTAAGACGACATTCCTCAAGAAAGA
GGAGGTCACTAGTGCTGTGTTTATGAAAATAGATTTATAGTGATATTTGGAGGGATTCAT
GAAATAACCTATGAGCTAAACGACCTTCACATCTTTGACATTAAGAATGGCAAGTGGTTC
TTATGTAATGAAAATAATTAAAATGCTTCACAGAGTGGTTCCCCTAAAAATAAAGCCATT
ATGTAGCAGAGTGATGCTTTCAAAAAGAATTAAAACGAATGGACGAGAATCACCCATGAA
TTCTACATTCTAGAAGAGTCCTCAAAATAAAGATTCAATGAATCAATCTATGAGAGGTAA
AAGTTTATTCTAGGCTCATATGAATCCATTAGCAGATTAAACAATGATAGAGACTTCAAA
AATTTAGATGAAGAGTCCCCCAAAACCATTGTAAATTTAAACTACAACACTTCACAAAAA
AGAGACTAAAGATTCACATGTGGAATTGCTAACTCCTACCTCAATCACGATGAAAAACGC
TTTCATAATTAAAAATGCAGATTAAAGTTTCGATAGCTACTTTCAAATGATGAAAAAACG
AAAGAATTTTGGAAATCACACTACTATGAATTCTCCAATAAAGACTGGCAAGAAATTCTC
GTTAAATAATTCAATGTAAAGCGGACACAACACTGGCAGTCATCACCATTAGAATAATAA
TATGAATTACAGTGCTTTCATAAATTCTGGGCATAGAGAAGATCCTGTCCCTTCTGTTAA
AATCACTGA


>Contig1147.1.g11(protein)
MDINVDDHENHDSYQNNHSSTNRRKELTINSNDCINQVCAWYELFMSGKLPHRRAYHVSF
YWNDHFYVHGGQDLKEGAYGDLWRVDYQFIFNETQLINDNQIQNIEWEEIQLSGVYPKKL
SHHAGILQPALQSYIIYGGIVGADSSDVLYVINLNNFNVQAIPSNQQTEKNGKSLPGPRD
DFWGYKNGQKMNDIFKLHILDRGRQFVWELLEIQGKSCPQPRSGFSGVCLHDSQGNEEVY
IIGGAGDNSNRFNDLWKYENHKWTLIATDGQDQDDIPQERGGHQCCVYENRFIVIFGGIH
EITYELNDLHIFDIKNGKWFLCNENNQNASQSGSPKNKAIMQQSDAFKKNQNEWTRITHE
FYILEESSKQRFNESIYERQKFILGSYESISRLNNDRDFKNLDEESPKTIVNLNYNTSQK
RDQRFTCGIANSYLNHDEKRFHNQKCRLKFRQLLSNDEKTKEFWKSHYYEFSNKDWQEIL
VKQFNVKRTQHWQSSPLEQQYELQCFHKFWAQRRSCPFCQNH