Identifiers and Description

Gene Model Identifier

Contig20545.0.0.g86

Standard Name

KELCH116

Aliases

Contig20545_0_0_g86

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008492500.00000000000007997998332353294Kelch motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20545.0.0.g86(coding)
ATGAATAATTACAGAAAAGAGAGCTTCAACGATTTAGATGATCATGAGGGTTATTACGAA
GCTGATGGAAACTCTCCAGACAAAAGAATTCAAATGAGTGTTAAAGTGAATTAGAATACA
AACAATCATCCACCACAATCTCTAGATTAGAATTATGATACAAACGACCAGTTTCATGAC
TCAAATAGCGAAGGTCCATATAAGCTGTGTCATGTTTGCAGGCATCAAATACTCTTACCA
ACTTAGACACCTGATGAAATTGAGCAAAAAGAGATTCTCTTTGAAAGCAACATACCACGA
TTTTCAAAGCAAGTAGTTTGTCCAAACAGTGTTTACACTTCTTAAAATTTAATAACTTAA
AGCGATAATGCTAAAGTATTTTGTATTGGAGGCTATATCACAGAGCCTAATGTTCCACAA
GTAAAAGTAGTTAACTGGACTTTAGAATACATAAAGGATCCTTCTAACTTCATTTAGCCT
AAGAATGGCATGATTACTCCAAGATACAGTCATTAAATAGTTTATTGTGAGAAACTTGGA
AGAATATATACCTTTGGTGGAATGGGCAGCTCATAAGGGATTTAGCTAATGGTACTTGAA
GATGAAGAATAGAACGATCAACAGAATACCTGGAAAGCTATCAAGAGCATGAATTATCAT
AGAGAGTAAGGAACAGCTTGCAGTTTCAATGATAACTTGATTTATGTGTTTGCAGGTTTA
GATAAAAGCTAAGAAAATCCTGATCAAATCATTCAAGTCATTGAAAAGTACGATATAAGC
AGTAATTAATGGGAAGTTATTAATTTACCTTATATTTACGGTTAATCTATGAGAGGAGCA
GCTTCTTTCTAAGGTACTGAGAACTCGCTCTATATTTTCGGAGGAAAGAAAAGTAATGAG
ACTACTACCTTTAAATCAAGTGAGATCTTAGAATTCAATACAAATGACAATTCTTTTAAT
TTTAATATGTCTATGGCTACAAAGATAATGGCATTGTTTTACTTTCATACTCTTTGA


>Contig20545.0.0.g86(protein)
MNNYRKESFNDLDDHEGYYEADGNSPDKRIQMSVKVNQNTNNHPPQSLDQNYDTNDQFHD
SNSEGPYKLCHVCRHQILLPTQTPDEIEQKEILFESNIPRFSKQVVCPNSVYTSQNLITQ
SDNAKVFCIGGYITEPNVPQVKVVNWTLEYIKDPSNFIQPKNGMITPRYSHQIVYCEKLG
RIYTFGGMGSSQGIQLMVLEDEEQNDQQNTWKAIKSMNYHREQGTACSFNDNLIYVFAGL
DKSQENPDQIIQVIEKYDISSNQWEVINLPYIYGQSMRGAASFQGTENSLYIFGGKKSNE
TTTFKSSEILEFNTNDNSFNFNMSMATKIMALFYFHTL