Identifiers and Description

Gene Model Identifier

Contig1316.0.g79

Standard Name

KELCH113

Aliases

Contig1316_0_g79

Description

Arylesterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1316.0.g79(coding)
ATGAAAGCCCCTTAACTTCTTGTTTTGTTTATGACTTTAGGCTTTGCTTCTCTAGTACAA
ATAAGTCCAAACAACAATAACAACAAGCTTTTCCTTTAGCTGCAATCAGAGGATTTAAAG
AAGTCTGGTAGTTTCAAACTCGTACAATCTGGGCAAGTAGCTAACACCACAACTGGCAAT
TCTACTCAACTTGATGTGATAATCGTAGACGATGATATTGATGAGGACTTAGTGGTCTCT
GAGAGAATCGTGTAGAAAGCAGAGGAGGGCAAGCATTTCTTCTTCCTTATGTCAGATAGA
ACTTCTGTTTGGGCTTACGATCCGGTTACTAACCTAAAGAGCCAGAAGATAGTGGGAGAT
CGCAAAAATATTAGAGCTATTGATATCGATAAGGAGAGGAATTACTTATACGTTGCTGAT
ATGATGGAGGGAAACAATAAGTCAGTTGTCATGAAATATCATCTAAAAGTTAATTCCACG
AACAAAAATGACATTAAAATCACAGTATTGCCTAACTCAACTTTTAAGGTCTATGATGGA
GATAGAGTGACTGGTATTGCCGTTGATGACGTAAAACATTTCCTTTTCATCGCAGAGTCT
GATAGATAATCCATTATCAAAATCGACTTCACTAACATCTATAACCCATTAGGAAATGCC
ACAGTGCTTTATTCAGGCTTACCAAGTCTATAAAACCTTTAAGGTGTTGTTTGTGACGAA
GAGCATGAACTTCTTTTCTGGGGTAACTCATAAAACGGAGCGAAGATTGGTGGAGTGCTA
TAAGCAAACTACTCTGGAATGACTTAATCCACCTCTGTGTTAAACACTCTTGATGTGATT
AGCGATATATCATATGAGGATGATTAACTTTACTATATAGTAAATGGAAACGAAATCTAT
ACTCAAGATCATGAAGCTAACAATTCTAAACCTATTTTAGTTAATAAGGGTTTCTTCACT
AATGCCTATAGAATCAGTGCTCTTGACGGTTATATCTACGTTACAGACGAGAAAATGGGT
CTATATTTAATTAAGACTTTTGACGACCCTATAAAGCCATTCGATGAGCCAGTAAAGCTT
GAATTTGGAAGTGAGCTTAAGGGTTTCAGAGCATTTACTATCCTTAAAACAAGTGGAGGT
ATTTACCAAATTATGGTTGGAATAACTACTTTGGCACTTTCATTGGCTATGTTTATGTTT
TGA


>Contig1316.0.g79(protein)
MKAPQLLVLFMTLGFASLVQISPNNNNNKLFLQLQSEDLKKSGSFKLVQSGQVANTTTGN
STQLDVIIVDDDIDEDLVVSERIVQKAEEGKHFFFLMSDRTSVWAYDPVTNLKSQKIVGD
RKNIRAIDIDKERNYLYVADMMEGNNKSVVMKYHLKVNSTNKNDIKITVLPNSTFKVYDG
DRVTGIAVDDVKHFLFIAESDRQSIIKIDFTNIYNPLGNATVLYSGLPSLQNLQGVVCDE
EHELLFWGNSQNGAKIGGVLQANYSGMTQSTSVLNTLDVISDISYEDDQLYYIVNGNEIY
TQDHEANNSKPILVNKGFFTNAYRISALDGYIYVTDEKMGLYLIKTFDDPIKPFDEPVKL
EFGSELKGFRAFTILKTSGGIYQIMVGITTLALSLAMFMF