Identifiers and Description

Gene Model Identifier

Contig11411.0.g117

Standard Name

KELCH110

Aliases

Contig11411_0_g117

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000669104.0009493637353324e-18Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11411.0.g117(coding)
ATGTAAATTTAAGAACCTGCTTCACCCAGTTAGAATATATTTAGTAAGCTTGCTGGCATT
TTCTCAAGGAAATAAACAGTTTAAGAATTAAAAAAGCAAAACACAGGATCTTCTAATGTT
TTAAGTCCAGCCAAGAAGAAAAGTATAGTTTTAAAGTAAAACACTGTGAATGTAAAAAAA
GGAAGTATTTCTCCAAATTCAAGACCAAGCAAACAATCCGTTATTCCTAACATTGAATAA
TTATTAAAAGAAAAACGCAACAATTCACAGTAACCCCCTGATAACAGCAAATTAAGAGAA
AGATAAGAAACATAAGAGCTCAAATTGCCATTAGAAAACTATTTAAGCAAGTAAAATAGG
TAATTCAGTTCAATAACTGCTCCATAGAACACAAACAACCTCATAGATAGGTCGATGGTT
GGAGATTCTTACAATACTATAAATTTCAAACTTCAATCTGAGGAGAATTTGTATCAGAGC
ATCGACTCTACAAACAAGAATAAACTTTTTTTGAATTTGCAAAGTCGGAAGCAGTTCGAT
GGGAGTTTAGGATAATCACCTATTGGAAGCATAAAAATGTAGTAATCACATGAAAAGGAG
CATGATGAGTCTTTTTCCAGCTAATCTTTAAGATCCAAGAGGACCTATAGTTAGGGGTTA
AATCCTAGTACAGTCTTAAAGTAAAGTTAGAATGATACACAAAGAACAAGTCAAAGGAAT
AAGTAATCCTTTGTGTAATAGAAATCTCAATAATCAATTCCATACCAGATAAATATAATT
CCTGATGAAAATTCTGGAAAGGATGTAAAACTATCAAATAGACAAAAGACTTAATAAATA
AAAAAGTCATCTTCAGCAGAATTTCTAGATAAAAGTTCTGTTGAACTGCAGAATGTGATC
AAGAACATGAAATATGAGGGAGAGCAAATTAATGGGTTTCAACTTAATACATCAAGTGAT
TAGGTGTAACATGAGATGTCGAGTATTGATAGAGATAATAATAGAAAGAGTGTCTATATG
CCTGCTCTGGATTCAATTGATGAGAATAGTGTTGAGGAAACCAAACTTGAATTAAGTAGA
GATGTAACCCAATCTTAGAGCAATATGATGTTGGGAGTTGAACAATAAAAATCCAAAAGA
TCTTCTTAATAAACCCCTAGTTTTTAAAATAGCTTGCAAATACCAGGTAACCACAGATTT
AAGAAGTCGTTAACTCCAGTTGAGCAAACTGACAAAAGTGATAACTTAATTATCAGATAG
AAATCTATCCCAGAAGTAGAAGTATCACTAGTGGATGGTAGCATAGTAGACTATACTATA
GTCGGAGGCAAAAAGAAAAAAAAGAAGAAGAAGTCTAGGAAATAAGGATAACTACTTCCA
CCAACTGCACCTAAAATGTCATCTAGCTTTTAAGGACCCATATAGAGGCTTCAAGAAAAT
AATGTTATATAGACAATAAAGGAAGATTTTAATGATATTAGCAGGTAAAATTTTAACTTA
GAGTCTACAATCAACTCAAATGGTACATTCACTTAGTCACCTGATAAGTTGCATGAACAT
AACTCAGCACTTTAAATGTTGACTCAAAAAATAATGCAAGACTTAAATAATCCTTAATAA
AATCAATAATCTGCAAACACAAATCCTTAGTAACTTATTTAAAAACGGTTGTTAGAATTA
TTATCTCAATAGAAATTCTAGAGAGCCCTTAATGATGAAAAATCTACAAAGAATTAAGAG
GAGTAACCAATTTAAAATCAGTAATAAGATCAATAGATTTAAAAAAAGCCGTCAATGCTA
GCAGAATTCTTGATGCAGCAAAAAAAGAAAATAAACTTAAAAGGAGGCTCAAATAACAAT
AATACCACTTAAGAAGAAACATCTTAAATCGATGGTAGTTAATAAAGATAAGGATAGCCA
CCAGATGAACATAGTTTGCTAGCTAGAACACTAACAAACACAATGAAGAAGCGATTCTAA
TAATACTAGCAACAACCTCAATTGGAACAAGAGTAATAATAATAATAAAATAATCTCAAA
ATTAACGTAGAGAATTAAGTGGGCAATCACAGATACTTCAATAATGACTCAAGACAGGAT
AGTATCGGCAACAACACCTTTTAAAACTTTTCACTTCCAGACATCAGTAGTGTTAAAAAT
GTTAAATCAAGAAATTAAACACTAAATGGTAACTACAATACAACAAGCAATGCAATGAAC
AGTTCTAAACTATCTCTAAACAACACTTCCATAAATTAAAAAGCCTATAATTAGCAATAA
TAAAAACAATAAAACAACTGGCAACAACCATTCTAAGATTAATAATCTTAACAATCCTCC
ACTTAACATCCTTGGGAATATAGAACCTTCACTTAAGCTTAAATGAAAAATACAAAAGCT
TTTGCTTTCAAACCTCTCGACATGATTAAGAGAGATATTGAGAGAGAAATGAGTTAATTT
AAGAAAGAAATTAGATAGATCAACCTAAGATGTGCAGCCTAGGGTAATGATTTGATATAC
CAAAAATAGTTGCTGCATAAAGTTAAAATTGAATTGCTAGACGAGAGAGAAGAAGAGTTT
AAGGGGCTTATGAGATCATTCATAGAATTGCACGAAGCACTTGATGATAGAATGCGCGAA
CTACAAAAGCAATATGATAGTCACATTGATAATACAATAAATTAAGTAGAGAACTGCATG
CACTAATTAGACAATTTAATTATAGGTCTGGATGAAGTATAAGAGAAAAATAAAGAATTC
TTGTTGGTAGATTAAACTATAGAAGATGATAAGGAGAAGATTGATTTCTTCTTGAGATAG
GAGTATCCAGTAAAATTCAGAGACATTAACTAAAAAATGCAAATGATAAAATTAGCTAAA
TTTGAGTTTCCATCTTTTGAGATTAATACAGAAAAGCTCAAGGAATCAATATCAAGAATC
GGTGCTTTTAAAGTAAACAGCATTGCTAATGTAAATTATGGAGTGCAGAGATTTTACAAT
TATAAAGACCCTTAAGATTCTTAAATGATATTTCAATTCAGATGGAATACTAAAGATGTT
TACTATTTTGACTCCGCTATTAATAAATGGACTTTAATGCAAGAATTTATACCTAAAGAA
CCATTTCTATATTTCTCATCAGTAGTGTTTCTTCCGAAGTAACTTGGCACTTTCATATTA
GGAGGTCTAGACTCTGCAGATCATTATTCGAAGCGTTGCTTATGGTTCAAGAAATATCGC
CAATTCTATGAAAAATGCCCCATGTTGCAAAAACGAGCGTTTTTTAGTAGTGTTTACTCT
CAAATTGATTGCTAGATTTATGTTATAGGAGGTTACGATGGTACAAACGATCTTCGACAT
TGTGAAAAATACTCACTCTATGAGAATGTTTGGAGAGAAATCACTCCATTAAATATACCC
AGAAATGGAGCATCTACTCTCTTACTGAAACACTTGAAATTCTTGTTTGCTCTTGGTGGT
AACAATAAGCAAGATGGCTCCTTAGATAAAATTGAAAGATATGATTTAGAGTTTGATACC
TGGAATTTAATTGATTTAAGATTGCCCATTCCGATGCACGATTTCTAGAATATAATTATT
CACAATAATTAAGATCAAGATGAGTATAAGCTTTTGTTATTTGGAGGGCAAACAACAAAT
GAACAAACAATAAACAGAGCTTATTTACTAGACATAACTCTAGAACTAAATCGGAATCCA
GAATCCCAAATTAATAAAAAACTAGGCAAAATATACTATCCAATTTCAGTAATAGATCAG
CGTCGTTGCTATATTTTCACTGGCTATAGCGATGAGCTCTTGAAACCCTACATTTTAGAT
TTCAAGCAATTTAAGTTAGAAAAAGTAAGAATGTAATAATTACTCAATGATAAGATGGGC
GCTGGATTGATTGGCAAAATTGAGAATGTCTTAAAATCATAAAAAGAACCAAATGAAAAA
TAATTTTAAGAAGATTAGATTAATCATTTAGACAAAATGAAATAGTACTAGGAGGATGAC
GATTATTACTATGATGCTAATAAGTAAGGGGGAGTTTATCACACTGAGTAGATTAAAGCA
CCATTAGGGCTAGTTGTTGATAAAATGAAGAGCAATGCTCCAAGTGAGGCTAATACAGAA
GATTTTTACAATTATAAAGGTTATGTTATCAGAAAAGTGGCAAAATGA


>Contig11411.0.g117(protein)
MQIQEPASPSQNIFSKLAGIFSRKQTVQELKKQNTGSSNVLSPAKKKSIVLKQNTVNVKK
GSISPNSRPSKQSVIPNIEQLLKEKRNNSQQPPDNSKLRERQETQELKLPLENYLSKQNR
QFSSITAPQNTNNLIDRSMVGDSYNTINFKLQSEENLYQSIDSTNKNKLFLNLQSRKQFD
GSLGQSPIGSIKMQQSHEKEHDESFSSQSLRSKRTYSQGLNPSTVLKQSQNDTQRTSQRN
KQSFVQQKSQQSIPYQINIIPDENSGKDVKLSNRQKTQQIKKSSSAEFLDKSSVELQNVI
KNMKYEGEQINGFQLNTSSDQVQHEMSSIDRDNNRKSVYMPALDSIDENSVEETKLELSR
DVTQSQSNMMLGVEQQKSKRSSQQTPSFQNSLQIPGNHRFKKSLTPVEQTDKSDNLIIRQ
KSIPEVEVSLVDGSIVDYTIVGGKKKKKKKKSRKQGQLLPPTAPKMSSSFQGPIQRLQEN
NVIQTIKEDFNDISRQNFNLESTINSNGTFTQSPDKLHEHNSALQMLTQKIMQDLNNPQQ
NQQSANTNPQQLIQKRLLELLSQQKFQRALNDEKSTKNQEEQPIQNQQQDQQIQKKPSML
AEFLMQQKKKINLKGGSNNNNTTQEETSQIDGSQQRQGQPPDEHSLLARTLTNTMKKRFQ
QYQQQPQLEQEQQQQQNNLKINVENQVGNHRYFNNDSRQDSIGNNTFQNFSLPDISSVKN
VKSRNQTLNGNYNTTSNAMNSSKLSLNNTSINQKAYNQQQQKQQNNWQQPFQDQQSQQSS
TQHPWEYRTFTQAQMKNTKAFAFKPLDMIKRDIEREMSQFKKEIRQINLRCAAQGNDLIY
QKQLLHKVKIELLDEREEEFKGLMRSFIELHEALDDRMRELQKQYDSHIDNTINQVENCM
HQLDNLIIGLDEVQEKNKEFLLVDQTIEDDKEKIDFFLRQEYPVKFRDINQKMQMIKLAK
FEFPSFEINTEKLKESISRIGAFKVNSIANVNYGVQRFYNYKDPQDSQMIFQFRWNTKDV
YYFDSAINKWTLMQEFIPKEPFLYFSSVVFLPKQLGTFILGGLDSADHYSKRCLWFKKYR
QFYEKCPMLQKRAFFSSVYSQIDCQIYVIGGYDGTNDLRHCEKYSLYENVWREITPLNIP
RNGASTLLLKHLKFLFALGGNNKQDGSLDKIERYDLEFDTWNLIDLRLPIPMHDFQNIII
HNNQDQDEYKLLLFGGQTTNEQTINRAYLLDITLELNRNPESQINKKLGKIYYPISVIDQ
RRCYIFTGYSDELLKPYILDFKQFKLEKVRMQQLLNDKMGAGLIGKIENVLKSQKEPNEK
QFQEDQINHLDKMKQYQEDDDYYYDANKQGGVYHTEQIKAPLGLVVDKMKSNAPSEANTE
DFYNYKGYVIRKVAK