Identifiers and Description

Gene Model Identifier

Contig11472.0.g80

Standard Name

KELCH11

Aliases

Contig11472_0_g80

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007603905.0001394847139716e-170Kelch motif family protein
SGDYGR238C5.0000961330688895e-23KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11472.0.g80(coding)
ATGGATTCATACGCTAGACATAATGGGGGTGGAAACCAAAACCCTCAATTTTCAGACCTC
TCAAACCCACAGATTATTGAAACACTACAGAAATAAAACATAGCTGCTGGTTAATAAGAA
GAAATATTATAAGACCCAAATCAAGAACAAACTTAAGAAGTTGAGAGAAAATGGTTATGG
GCTTTTCCATAAATCGAAGGTGTACCTCCAACTCCAAGAGGAGGTCACTCTGCCACCTTA
ACTGGTGCCTCACTGGTTATCTTTGGTGGACATTACTATGTTGGTCAAGAAACTGGATTT
TAGTATTTAAATGATACGCACGTGCTTGATGTTAACTCTTCAAGATGGATTAAACCTAAA
ATTTCAGGTACTCCACCTCCAGCAAGATATGGACATTCTTCTGTGCTTGCAGGTTCACGT
ATAATTATATTTGGAGGCAAGGGGCCAAAAGGTGCAGTGTTCAGAGATTTACATGCGCTT
GATCCAGTCTCAATGACTTGGTATCAGGGACCAGAGGGTGGTGGTGCACCTTCTGCAAGG
TTTGATCATACTGCTAACTTAGTCAGTGGAACCAAGATGTTCGTCTTTGGTGGATGGAAT
GGTCAAGATTTCTACAACGATGTTTATGTTTTAGATCTTGAAATTATGGCCTGGTCAAAG
CCAAACTGCACAGGCCCTGCTCCAAGTCCCCGTAAAGGCCACTGCTCGATATTAATAGGA
ACTAACTTGGTAGTCCATGGAGGTTTCTAATTCTCTGAAGATAAGATGAAGAAAATTGGC
CCAAATAAGATGGGATCATCTTTGCAAGAGTGCTATTTGAATGACATCAGAGTTCTAGAC
ACTGAGAGTTTCATTTGGAGCAGATTGAGAGTGAGTGGATCTCCCCCTGAACACAGATTT
GGCCACACAATGGATATTTCTGGATCAGACATTATTTTATATGGAGGTTGGACAAAGACC
TCTGGCGCAAGATTTAAGCATGAGCCCACTGAAGAGTCATGTGACTACTTTATGATTTGG
TCAACTGACACAATGAGCTGGAAGCGTGGACAATACATTGGAAATCCACCCACAAGCAGA
TTTGGACATACGAGTACATCTATCGGGCCACATTTGCTTATCTTTGGTGGTTGGGAGTAC
ACTAAAGCTCAAAATGAAATCATTGTGCTCAGAGAGTGCACTAACAAATTAATGGGAGAT
GGACAGGAAAATAATGGATAGTGA


>Contig11472.0.g80(protein)
MDSYARHNGGGNQNPQFSDLSNPQIIETLQKQNIAAGQQEEILQDPNQEQTQEVERKWLW
AFPQIEGVPPTPRGGHSATLTGASLVIFGGHYYVGQETGFQYLNDTHVLDVNSSRWIKPK
ISGTPPPARYGHSSVLAGSRIIIFGGKGPKGAVFRDLHALDPVSMTWYQGPEGGGAPSAR
FDHTANLVSGTKMFVFGGWNGQDFYNDVYVLDLEIMAWSKPNCTGPAPSPRKGHCSILIG
TNLVVHGGFQFSEDKMKKIGPNKMGSSLQECYLNDIRVLDTESFIWSRLRVSGSPPEHRF
GHTMDISGSDIILYGGWTKTSGARFKHEPTEESCDYFMIWSTDTMSWKRGQYIGNPPTSR
FGHTSTSIGPHLLIFGGWEYTKAQNEIIVLRECTNKLMGDGQENNGQ