Identifiers and Description

Gene Model Identifier

Contig14586.0.g90

Standard Name

KELCH10

Aliases

Contig14586_0_g90

Description

Galactose oxidase, central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000377601.9990449803848145e-49Kelch motif family protein
SGDYGR238C9.000561397357242e-21KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14586.0.g90(coding)
ATGCAGCCTTAATAAAACCTGAACAATGGTCAGAATATTTAAGCACCTTTCAGCTCCTCA
ATGTCTTCATTTATGTCTGCGGCCAGTCACCCTTCGGCTATCATGGATGCTGAAATGACA
AATGCCAGTAATCAGTAATTTAATCCAGATTAACAGGATTATTGCTGGTAGGTCATTAAG
ATCAATGGGCAGCCTCCATCAACGAGAAATTGTCACTCAAGCACTCAATTTGGTCAATAC
TTGATTATATTTGGTGGTAGAGAAGGAGATGGAAAGAAGAGAATTGTTAATGATATTTAC
ATCTTTGACACAGAAAAATCGCTTTGGTTCCAACCAAAAATAGACAAAGCGAAACTGCCG
CAACTGCGAATGGGTCATTCAGCTTAACTTTGGAAAGGCACTCACATTATAATATATGGT
GGATGGAACGGTGCTTAAGTTCTTTCAGACGTGATATTTATCGATTTGAGAAAGGGAGTG
GACAAAATGCAAATTGTTATTCCTAGTATGATTAGAGGAGAGGCTCCTATGAGACAATTT
CATACTGCTAATATCATTGATAACTAAATGTTTGTGTTTGGTGGAGGAGATGGAAAATAT
TGGCTTAATGATCTACTGATTTTCGATTTAGTTAATTTAGAATGGAGTGGACCAATTTAA
ACAACAGGCAACGCACCGGTAGGGAGACTTTAGCATTCCGCAATAGCTTATGAAAAGAAA
ATATTTATCTGTGGAGGGGAGCCAGACTAGTTTAGATAACTAAATGATATCTTCTGCTTA
GATACAACAAACCTAACTTGGTGCAAACCTCAAGTCACAGGTGATGAGCCTACAGCAAGA
GTTTCGACCACAGGATGCTTAATAGACTCCAGAATTTACTATTTTGGTGGTTATGACGGG
GTTCACTGGATGAATGATGTGCATGTCTTCGATATTGAAAATAACAGATGGTCGAAAATA
GAGACATACGGGTATAAGCCAAGACCTAGATGCCGACATACAGCAAACATTGTTAAAGGA
CAACTCTTTATATTTGGTGGTAATGACTGTGAGCTGAGTTTCAATGATATTTTGGCTTTA
CCCATTGGAGTTCAAGTTCCAGAACCAACTGTTTTAAAGGATATGCTAAGCATGCTAGAA
AATGGAACTTTTGCTGATGTAACGTTTATACTTGGTGAGACTAAACTTAAAGCTCATAAA
TGTATCCTGGCATCTAGATGTAATTTCTTTGAAAGTATGTTTACAGTTGGTATGAGGGAG
TCACAAGAATCAGTCATAACAGTACAAGATATTTCAGCCATTACTTTCAAAAACTTGCTT
GAATTCATCTATTCAGATCAGGTCAACTTTTCTTAAATGCCCTAAGAGCAAGTCATAGAT
ATTCTAGTAGCAGCCAATAGATACGGGTTAGATCGTTTGAAGAGACTTTGTGAGAAAACT
CTGGTAAAATATATTGACCTCGATAATGTCATTGAACTCTTGTACATGAGTGACATGCAT
CAAGCAATCGAACTTAAGCGCATGTGCATTAACTTCACTATGAATTACTTTGACATAGTC
ACAAAGAAAGAGGAATTCAAAAAACTATCCAAGAGCATTCTTTTAGAATTACTTCAAAAT
AAATGA


>Contig14586.0.g90(protein)
MQPQQNLNNGQNIQAPFSSSMSSFMSAASHPSAIMDAEMTNASNQQFNPDQQDYCWQVIK
INGQPPSTRNCHSSTQFGQYLIIFGGREGDGKKRIVNDIYIFDTEKSLWFQPKIDKAKLP
QLRMGHSAQLWKGTHIIIYGGWNGAQVLSDVIFIDLRKGVDKMQIVIPSMIRGEAPMRQF
HTANIIDNQMFVFGGGDGKYWLNDLLIFDLVNLEWSGPIQTTGNAPVGRLQHSAIAYEKK
IFICGGEPDQFRQLNDIFCLDTTNLTWCKPQVTGDEPTARVSTTGCLIDSRIYYFGGYDG
VHWMNDVHVFDIENNRWSKIETYGYKPRPRCRHTANIVKGQLFIFGGNDCELSFNDILAL
PIGVQVPEPTVLKDMLSMLENGTFADVTFILGETKLKAHKCILASRCNFFESMFTVGMRE
SQESVITVQDISAITFKNLLEFIYSDQVNFSQMPQEQVIDILVAANRYGLDRLKRLCEKT
LVKYIDLDNVIELLYMSDMHQAIELKRMCINFTMNYFDIVTKKEEFKKLSKSILLELLQN
K