Identifiers and Description

Gene Model Identifier

Contig15737.0.g3

Standard Name

KELCH1

Aliases

Contig15737_0_g3

Description

Kelch motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008024205.0000961330688895e-23Kelch motif family protein
SGDYGR238C0.00000000000009996062864481225KEL2 SGDID:S000003470, Chr VII
from 968687-966039, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15737.0.g3(coding)
ATGATAGAAGAAGAACAAAGTGTGAAAGTTAATTCAGTGAGTTTACTGGATTACTTAAAT
AACAGATACCCTGACAGATAAAAGGAGATTGCGAACATATTTGAAAGCTACGAATCCTAA
CTCAAACTCTACTCTGAGCGAGAGGGTGGGAGACACCTGAAGTACAAGTACTTTGAAGAT
CAGAATAAGAATCTGACCACCAACCTTCCCTCAGCTATTACCAATATTCCAGGGGTTCCT
TCCTTCAATTCTCAGCATCACCAGTCTAATTAATTAGCTTCAAATTAACATGGAGCCTGC
TCATTCCCATACTTCAACCAGCTGCATGATTAGATCAGGGAAGTTATAGGTCCAGAATAG
TTTTTGGAGTCAATTAAGAATTATGTCTAGGCACCCGAACATACTCAAAAAGTAAAAGAA
GAATTAAATAGACTAGAAAGAGAGGTTATGAACATTGAAGCAAAAGAGGAGGAAAAGATG
TTACTCTGCGGTTTACCAATTTTAAGAGACACTCTAACATTCAAACATTTTGAGCACTCA
ACTTTAGGAAATGATATTTAAGAAGAGTTTAAGAATGCAAAGTGTATTGTTCTCACAACT
CCAGCAGTGAGTAAATAAAGCGGGAAGGCCAACGGAAATTCACAAATGAAAGATTCTCTC
ATATCTAATACCATATAAATTTCTAACGGCAACAATGGATTGGGAGCTACTCTTTCAAAT
GTATCGCTCTAGAAACCATAATCAGCCATTAACAGTCTAAACTAGACTAGTTCTTAAGTA
GGGAAAATAATAAACCCACCTCCTCAGAAAAGATACGGCCATAGCGCAACCCTTGTAAAA
AATAAGATGTACATTTTTGGAGGTTTGGCTTCTTAAATGAAAGGCGGCAATTTCCAAACC
TTCTACGAGTGCCAATTAAAGTTTAACTCAGATGATGGCACCCTCTTTAATTGGGAAAAA
ATAAAATCAGATGCGCCTAAAGCTAGAGATTCTCATTCGTGTATCCATGTTGGTGATTCT
TTAATACTTTTTGGAGGGAGTGGAGGCGCCACGAGCTTTAATGATCTCAATAGATTCGAT
ATTAAAACCCAAAAATGGGCCAGACTCGATGCTCAAGGTGAAATCCCGGTTCCAAGAGAG
GGTCATACAGCCAAAGCTATTGGAAGAGATAAAATGATGATACATGGAGGTGTAAATCAA
AACGAAATTTCTTTTGATGACACTTATGTGCTTACTGGCCTTTCACAATTAACTGAATCC
TAATAGTTAAGCATCAATAATAACTTTGAAAGCAAGACAGTGTCTCCTATTCAACTAACA
TTTGAAGGGCTGAATAATCCTACAAGCTACGAGACCAACACTTCAAATACTCTCAGCATT
CTTAATAAGTAAAATAATGGGCAGTAAGGTTTCAATAATAACGGAAAAGCCTTAAATTAA
CTAAGGTGGTATAAATGCATTCAGAGAGGCGATATACCATAAGGAAGAGATAGCCATTCA
AGCGCCTTGATCAATAATAAAATTTACATATTCGGCGGATAAGGCGACAACGATATTATC
TTTAATGATCTGTATAGTGCTGAAATTATTGAAGAATTAAAAGAAAATGGTGAAATATAG
TTTGTTGCACAGTGGACCAGGTTAGAATAATAGACTCCTATCGAGTTAATACATACAGTT
TATAAGCCAACATCTAGGACAAGTCATACTTGCACAGTCTATAAGAATAGGTACCTTATC
ATAATTGGCGGTGAGACAGTTCCAAGTGCATAAGATTAAATCAAGAAATAAATTAATTAA
CCTCCATAAACAAAACTTAAATCTAATTTAGACATTAGCATTGATTTAGAGCAAGAATGT
AATGTGTCAGAATAGGAAAACGATAGTAGCTAAAAATAGAATGAGGAGTCACCTCAGGTC
TAAGAAAACTTGAAATTCTTAAATGATGTATGGATCTATGACACTATACTTTTCAAATGG
CATGAAATTAAACCACATTTAAAGATACAAGGTCCTCTAGCTGGCAAGAAAATAAAAAAG
GTTTTTGAACCTAGGATGGCTCATTCAGCTGTGCAGTATGATCAATTTGTAATTATTTTT
GGAGGATTAAACCAAGAAAGATAGCCAATCTCAAATGACCTCTTTATTTTAAGTTTGGAT
GGCGAACTGGGAGCTATTTAGAAATCATTAGAGAGTGGTTAAGAATCTAAGCAATAAATA
CAGATACCAGAAGTAAATGTTTTAGAAAAAGTTTAATCAGCCCAGGGTCCGGGATAAAAG
GATAAAATCAAAATTGCAAGAACTTTAAAAATCACAGAGCCTGAAGATAGAAGAGAAATG
TCAGGATAAATTCTGAACTAAATTATTAATTTCAGTAGCAATCAGACTAATCAATATTTC
TTGAATGGGAACCAATTTTATGCTAGTTCTAATCCTACATAAGCATTTGGATTGAATGGA
TCCAATCAATAATAAAAGAAAGATTGTTAAGTTCAAACCTGTGATAACAGCAAAGACTTA
CCGTCTATTTAAGCCCTAGAAAAGCAACAGATAGCTCTAATTATGAGATCAAACGATTTT
TCAATGAGAATATTCTAGAGAACTAAGCTTTCCTTTTTCAAAAATCTTATAAGGTAAATA
GAATGGCCGCTATAGTGCTTTGGAGGGTTCATTGATAACTCTATCCAAGCATTTGAACTC
TAGAGATATAAGTAAGAGCAGCCAAGGCAAATGCATCATGGCTCCATTTAATCAATGATG
AATACCTATGTGAGCTCAAATCAAAAGATGCATAGCATCACTATTGAAATCAATATGAAG
AATTATAGATCTTAATAATTAACTAATACTACAGGGTACTTTGGAAAAGATCAGTATATT
GAAGTTAAAGATAATGGCCCAGGTATTCATCCTAAGCAACTAATGGAAGTCTTAACATCT
TTCGGTTCTTCAAATTTGTTGAACATTAAGAGTGACTATAATTTTAGCGAGCATGGCATT
AACTTGAAAATATGTGCTTTAAGACTTGCAAATAATGCTTTGATAATCACTAAGACCAAA
CCTATAGTTGAGTATGGCAGCACAAGTCAATATCTTAGTATTGCACTTCTGTCCATAAAG
TTTGTTGAAGACGCGAGTTCATAGTTCTTAGTTTGCCCTATTATAGCGTTTGAACTCAAA
AACAAAAAGATAATAAAAAACTTAACTCCTCAACCAGAGCATTTCCTTAATAAAATTTCT
CATTATACTTAGCCATTGTTTGAGAGTGGAGAAAAAATTTAGTAATATGCCATGAATGGA
ACAGGTGATTGCGGCACCTATATTATTATGCTCGATCTTTGCCAGTAATCCTTCTCTAAA
TAAGATAACCATCAAGAAATCGGAGCTTCTTCAAATGACATAAAACTCAATCCAAAATGT
TTCGTCAATGAATGCCAAGAAGATCTTATAGAAAACTCCTTGAGAACCTACCTCAAGTAT
CTCTACGTTGAGCAGCCTGAAAGTGTGAGAGTTATTTTGAACGGGTAGTAAGTTGACATG
TAAAATCCATATTCAGCTCTCAAACTTAAAATGCCTCATGTTTTCACTGGAGATAGATAG
GAAAAGTTTGCAGCTCAAATTCTCAACGAAGATATGCTAAAGTAATCTTATGAGTAAGTC
AAAAGTGAGCAAATTACTGAAAATTAAGAAGATTAAATAATGGAGTAGACAAAGGAAGAA
GACCCTAACTAATGGTTGAAAGATCTCGCTTAGTTGCAAGGAATTCTGGTATATAGGGGT
ACAGGCAGATTGATCAGAAGAATAGAGAATGTATTTGGTGAAGACGAAGATTATAGATTA
CAGAACTCTTTCAAATATGAAGATATTGACGGTGTCTAAAAGAAAATCTTTAAGAAAAAT
GGAATTATATCTGTCTTCAAATCTAAATCCTCAACTCTGATTGACAAAAGAGATTTTTCA
GACAAGCAAATCATCAAGAGAATGAGACAGTGGATGAGAGAGAAAGACGCAGCTTAAAAT
GTTAAAGATTAAATCATTCTGAACCCTTAAACTCTTGAATCAGCTTTGGATTACAGTATC
ATAAAGCCAGATTAAGATGACATTGTGAAAGAACAGTAGGAGCAAAACCTTGAATTTAAG
AAAGATTAATGA


>Contig15737.0.g3(protein)
MIEEEQSVKVNSVSLLDYLNNRYPDRQKEIANIFESYESQLKLYSEREGGRHLKYKYFED
QNKNLTTNLPSAITNIPGVPSFNSQHHQSNQLASNQHGACSFPYFNQLHDQIREVIGPEQ
FLESIKNYVQAPEHTQKVKEELNRLEREVMNIEAKEEEKMLLCGLPILRDTLTFKHFEHS
TLGNDIQEEFKNAKCIVLTTPAVSKQSGKANGNSQMKDSLISNTIQISNGNNGLGATLSN
VSLQKPQSAINSLNQTSSQVGKIINPPPQKRYGHSATLVKNKMYIFGGLASQMKGGNFQT
FYECQLKFNSDDGTLFNWEKIKSDAPKARDSHSCIHVGDSLILFGGSGGATSFNDLNRFD
IKTQKWARLDAQGEIPVPREGHTAKAIGRDKMMIHGGVNQNEISFDDTYVLTGLSQLTES
QQLSINNNFESKTVSPIQLTFEGLNNPTSYETNTSNTLSILNKQNNGQQGFNNNGKALNQ
LRWYKCIQRGDIPQGRDSHSSALINNKIYIFGGQGDNDIIFNDLYSAEIIEELKENGEIQ
FVAQWTRLEQQTPIELIHTVYKPTSRTSHTCTVYKNRYLIIIGGETVPSAQDQIKKQINQ
PPQTKLKSNLDISIDLEQECNVSEQENDSSQKQNEESPQVQENLKFLNDVWIYDTILFKW
HEIKPHLKIQGPLAGKKIKKVFEPRMAHSAVQYDQFVIIFGGLNQERQPISNDLFILSLD
GELGAIQKSLESGQESKQQIQIPEVNVLEKVQSAQGPGQKDKIKIARTLKITEPEDRREM
SGQILNQIINFSSNQTNQYFLNGNQFYASSNPTQAFGLNGSNQQQKKDCQVQTCDNSKDL
PSIQALEKQQIALIMRSNDFSMRIFQRTKLSFFKNLIRQIEWPLQCFGGFIDNSIQAFEL
QRYKQEQPRQMHHGSIQSMMNTYVSSNQKMHSITIEINMKNYRSQQLTNTTGYFGKDQYI
EVKDNGPGIHPKQLMEVLTSFGSSNLLNIKSDYNFSEHGINLKICALRLANNALIITKTK
PIVEYGSTSQYLSIALLSIKFVEDASSQFLVCPIIAFELKNKKIIKNLTPQPEHFLNKIS
HYTQPLFESGEKIQQYAMNGTGDCGTYIIMLDLCQQSFSKQDNHQEIGASSNDIKLNPKC
FVNECQEDLIENSLRTYLKYLYVEQPESVRVILNGQQVDMQNPYSALKLKMPHVFTGDRQ
EKFAAQILNEDMLKQSYEQVKSEQITENQEDQIMEQTKEEDPNQWLKDLAQLQGILVYRG
TGRLIRRIENVFGEDEDYRLQNSFKYEDIDGVQKKIFKKNGIISVFKSKSSTLIDKRDFS
DKQIIKRMRQWMREKDAAQNVKDQIILNPQTLESALDYSIIKPDQDDIVKEQQEQNLEFK
KDQ