Identifiers and Description

Gene Model Identifier

Contig8015.0.g73

Standard Name

KDM6

Aliases

Contig8015_0_g73

Description

TPR repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR112C2.0008958828286524e-54CYC8 SGDID:S000000316, Chr II
from 465770-462870, Genom...
T. thermophilaTTHERM_003480900.00000000000040012475857291343TPR Domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8015.0.g73(coding)
ATGGATTAAGAACAACAGAGACAATTACTACTACAGCAAATGCTGCGACAGTAGAATCCC
CTTATGGGATAGTAAATGATACAGCCAGGAGTTGGTCTTGGAGGTGGATAATTTTTCGGG
TAATAAGCACTTTAAAATTAAGGGCAGCTCAACCCTGGATAACATGGTTAGCATACTTAG
TAACCAGGGACATTGGGCGGCGGATTCTAGCATACTATGGGCGGCCAAATCAACTCATAA
TTATTTAATCCAAATGCTGCTGCCATGTTCTAGCAACATCAGCAACTCTAGCCTGGTAGT
AATCAGGGCCAAACTGGATAACTTCATGGTTAAATTGGAGCTGGAGCATCACTTCAGAAA
CCTTAAGTTTAATCAGGTTTGATATCCGGTCAAGTCCAATAGAATCCAGGTTAACACTTA
ATAGGTGGGCCTTAAACAGGCATTCTGGGCTAAATGGGAAGCGGAATAGGCGGTAGTTAA
GGCCAACAGCCTACTAATCCCTTATTACTTGGTAACATGATGCAACTGTAACAACAAATT
CAACAGTAGCAGTAATAAATGTAGTAACAACAACAGCATATGCAGTAGTAATAGCAGCCA
TCCAATCAGTCAAACTAATAGTAGCAGCATTAAGGTTTCTCACAAAGTCCAGGGATTGGA
CAACTACCATTTTAGTAATTAGGATAATAGATGGGAGCTGGATAACACCAATTAGCTGCC
TACCTAAATAAGTTCCAGGACATGTAGGCTCAGTCAAATCAAGGCAATACTCAAGATACT
CAAGGTGCAAAATCTTAGCAAAACTAATCCTCAAACTTGTATGGATAGATGCAAGGATAA
AATCAACTTGGAGGCCAAAATCAAAACTCAGAGTAGTAGCAACCTAACTCCTAAATGTAA
AACTAGCAACAATTAAACCCAAATGCTTCGAATATTCATCAATTGAACTTCCTTGGCTAG
CTCTAACAACCAGGCGGATAAAACCCACCTTCTTTGTCAACTCCTCAACTTCAATTTTTT
GGTTAAAATTTCCCAAACCATCTCTAAAACCAAAACAAGATTGGAGCGATTGGGCAAAAC
TAAGGTCAAAACCAAATGCAAGGCATGCCCCAATAACTTTAAAACCAGTAGAAGCCACAA
GGAATCGGATAGCTACCAGGTTAATTAGGACAGCAGAATCAAAATTAACCAGGAATGATG
CCTTAACTTCAACAATAGCAAAATTAAATGAACTAGCCAGGATTGCCATAGTAGTAGTAA
TAGTTATTATAAAATAACTAATAAATACCATCTTTAAACCCACAAGGGTTGAGAACTGGA
TCTAGTCTATAAGGTACAGGACTTGCAGGTGCTGCTATGCAAGCTGAGAAAAACTAATAG
ATGGGTACTGGAAATCAATAACCAGGAGCACTTCCCAACATTGCAGGTATGTAACCAGGA
TAAAATCCATAAATGATGAATGTTGCTAATCTCAACAAACTTGCTGAGTACTGTGCCACA
AACGGAGAGTACCATCACGCCATTGAGTACTATCTCCAATTGACAAATTTAGACCCTGAT
AATGGACCAGCATGGACAGCTTTGGGTCATTGCTACCTTTTAATTGAAGATCTTCAAAAG
TCTTTCAATGCCTATTAACATGCTCTTTATTCCTTGGAGGACATTAAAGATCCTCAACTA
TGGTATGGTATTGGAATCCTATATGAAAAGTTTGAGTCATATGATCATGCTATAAGCGCA
TTGATTGCAGTGCTCAAGATGTCACCAAACTTCTACCAAAAGAGTGAAGTACTCTATAAA
CTTGGAATCATCTTCGCAAAAACCAATTAAATCGAGCAAGCCATCAGCTACTTCCAGAAC
TCAATTTTGACGAATACATTTACTGTAAAGAGAAAGGTTGACACTCTGTTAAAGATTGGT
CTTCTCTATGAAGAAAATAAGGATTACACTCAAGCACAGAGATCCTATGAAGCAGCTCTA
AATCATGATGATAATAACTACAAGATTTACCAGCACCTAGCTTGGTCTTACTTCTTACAA
GGTAATATTAACACAGCAGTTGAGTTCATTAAGAAAGCTGAAAAGAAAAACAAAGGTCAA
GCTGATTCTTATTATATCTAAGGTAGATGCTTCATGTGTCTTGAAAACACTAAAGAAGCC
TTAGAAAATTTCTAATAAGCTGCCTATAAAAATCCTGGAGAAGCAGTCTACTGGGCTACA
CTAGCAATCTTTTACTACAACACTGCTAATTACACTGATGCCTTCGAAAATATCATAAAA
GCTACTACTTTAAATCCTTAAATGAGTGAAATATGGTACAATTTGGGAGTTCTCTATGAG
AAATGCAGACAGCCAGAGGAAGCATTGATTGCTTACAGCAAAGTCCTTGAACTCGACAAT
GACGACTAAGATGCCCAAAAGAGAATCATAACTATCAAGAATCCTCAATATCAGATTGAA
CAGAGCAAGAATCAGTTTAACTTACAAATGAAGTACCCTAAGTTCACTCTTCCAAACTCA
TTGATGATTCTCAGAAAATATAAGAAATCTAATCCCAATCAGAAGCCAGTTACAACAGGT
AATGAATAATTGCAAAATCCCCTTGAGAGCCAGCTCAATCATTCATTAGGCTAACTTCCA
GGTATCCTTAATAACTAGGGATAAAATCTTTTAGGTTAACCAAAACTTGCAGAGAACACT
CCAGGCAATCTTCCAAATTAAAACAACTTAGCTGATGCTATGAATCCAAACAAGTTAAAC
TTCCCTCAATCCCAACAACAATTCTAGGGTCAGTAGTAAAAGTCAGAAATGGAAAACCCT
CAAAACAACCCTAATTTCGGAGGGTTTAGCGCATTCAACCCACCCTAAGGTATGGCTAAT
CTGAATCAAAATAAAATGGGAGGAGGACTTGCTGGTATGTCAAACCCAGATAATATGGTC
AATAAACTTAGTGAAATTCACTAGATTCTCAAGCCAAGTGGAAACAACTTGCCCCAATCT
AATACACCCAATTAAAACATGCTCGGTGGATTGGTAAACCAATTATAAGGCAATATGACA
TAGGGAGGATCAACTAATCTTCCATAATTAAATATTGGTGGTCAACCAAACTTTTCGTAG
TTAAATTAAGGCCTACAATAATAACAACAACCAGGCATAATTGGACAAGCTTAGAACCTC
CCCACAATGAGCCAAGCCTAACCTGGTTAAATGAATTAACCTTAACAAGAGCAAACGAAT
AATGGTTAGTAAGTCCCAACTCAATTAACTCCCTCTAATGAAAGTTTGATAAACATTCAA
AAGACTAATTTGAATCAAATACTTCAAAGTTTACCCCAAAACATCAATCTTGCAAACCTA
AGCAGAGAAGACCTCCTCAGTCTTTTGCAAGATCAATAAGTATAGCAAAAAGCCAATGAA
ACGCAAGTTAACTAGATCGTTTAATAGTAGCAACAATTAAAACAACAATATTCCCCTTAG
GAATAATCTGAGGCTTAACAATAACAATTTAAGAGCTAAGAGGAAGCTAAAGGAGATACC
TAATAACAGGCTCAACAACAATAAACTGCCTAGGCTTCACTTTAAAATGAGATAGCTTAA
TAAGAGTTCAATTAATAGAATCAGCAAAACCAAATCCAACAGCAATTGCCTCAAATTTAA
TCCTCTTAGATGCCAAACTTCCAAGGATTAGCAGAGCTATAATAGCATTAAGCAAACGGT
CAGACAGCCTAGTCTAACTAGTAAACTATTAAGACTGAGGACCCTTAAACGAGTATCAAT
GACATAGTTTCGTAACAATAGAAACTTCTTTCTCAAAATGGTATGCTGCCAAATATGTAA
GGTAATTCAGGTATCCAGTAACTTAATGGGCTTACCCCAAATCTTCAAAATCTCACTTAA
ATGTATAATGCTGCCTTCTTAAGTTAAATTTAATCAAACCCAGAGTTACAACAAAACCTC
TTGATGCAGTAATAGTAACAGTAACTTGAACTTCAGTAACAATTAGCTCTACAAGCTGTT
CAATAATAATATGCAATTCAATAGTAATAGCTTCAACAATTGTAAAATTCAGCTAATTAG
GCTTAAGAGTCGCAATAAGAAAAAGCTTAACAGCCAGCCTCGAACGACGCAAACGCATAA
CTTTTGAATAACATTTAACAAATGTAAGACCAGGCAGCCATCGATCAGTTCTAACTGAAT
CAACTCCAAGCTCTACAATAGTAACTTCCTAATTAAGACGCTCAATCCATTATGCTCCAA
GCTCAATAGAATCAAATTGACTAAGCCAATCTTCAACAGTAATTACTTTAACAGTAGCAA
TAATAACTTGAAGCAATAGCTCAATAAGAATAACACGACAATGGCGAATGCTAGAATATT
GAAGACTAAAGCAAAGCTTAATAATTCTCAGCGCAAGTATAATAAGAAGAACCAGTACAA
AGCACAACTGATGCTGTTCATCAATAAGAGACAAATGGGGCAGTGGAAGTTGATAATCAA
TTATAGGCTGAATAAGTAAATTAAGAATAGTAATGA


>Contig8015.0.g73(protein)
MDQEQQRQLLLQQMLRQQNPLMGQQMIQPGVGLGGGQFFGQQALQNQGQLNPGQHGQHTQ
QPGTLGGGFQHTMGGQINSQLFNPNAAAMFQQHQQLQPGSNQGQTGQLHGQIGAGASLQK
PQVQSGLISGQVQQNPGQHLIGGPQTGILGQMGSGIGGSQGQQPTNPLLLGNMMQLQQQI
QQQQQQMQQQQQHMQQQQQPSNQSNQQQQHQGFSQSPGIGQLPFQQLGQQMGAGQHQLAA
YLNKFQDMQAQSNQGNTQDTQGAKSQQNQSSNLYGQMQGQNQLGGQNQNSEQQQPNSQMQ
NQQQLNPNASNIHQLNFLGQLQQPGGQNPPSLSTPQLQFFGQNFPNHLQNQNKIGAIGQN
QGQNQMQGMPQQLQNQQKPQGIGQLPGQLGQQNQNQPGMMPQLQQQQNQMNQPGLPQQQQ
QLLQNNQQIPSLNPQGLRTGSSLQGTGLAGAAMQAEKNQQMGTGNQQPGALPNIAGMQPG
QNPQMMNVANLNKLAEYCATNGEYHHAIEYYLQLTNLDPDNGPAWTALGHCYLLIEDLQK
SFNAYQHALYSLEDIKDPQLWYGIGILYEKFESYDHAISALIAVLKMSPNFYQKSEVLYK
LGIIFAKTNQIEQAISYFQNSILTNTFTVKRKVDTLLKIGLLYEENKDYTQAQRSYEAAL
NHDDNNYKIYQHLAWSYFLQGNINTAVEFIKKAEKKNKGQADSYYIQGRCFMCLENTKEA
LENFQQAAYKNPGEAVYWATLAIFYYNTANYTDAFENIIKATTLNPQMSEIWYNLGVLYE
KCRQPEEALIAYSKVLELDNDDQDAQKRIITIKNPQYQIEQSKNQFNLQMKYPKFTLPNS
LMILRKYKKSNPNQKPVTTGNEQLQNPLESQLNHSLGQLPGILNNQGQNLLGQPKLAENT
PGNLPNQNNLADAMNPNKLNFPQSQQQFQGQQQKSEMENPQNNPNFGGFSAFNPPQGMAN
LNQNKMGGGLAGMSNPDNMVNKLSEIHQILKPSGNNLPQSNTPNQNMLGGLVNQLQGNMT
QGGSTNLPQLNIGGQPNFSQLNQGLQQQQQPGIIGQAQNLPTMSQAQPGQMNQPQQEQTN
NGQQVPTQLTPSNESLINIQKTNLNQILQSLPQNINLANLSREDLLSLLQDQQVQQKANE
TQVNQIVQQQQQLKQQYSPQEQSEAQQQQFKSQEEAKGDTQQQAQQQQTAQASLQNEIAQ
QEFNQQNQQNQIQQQLPQIQSSQMPNFQGLAELQQHQANGQTAQSNQQTIKTEDPQTSIN
DIVSQQQKLLSQNGMLPNMQGNSGIQQLNGLTPNLQNLTQMYNAAFLSQIQSNPELQQNL
LMQQQQQQLELQQQLALQAVQQQYAIQQQQLQQLQNSANQAQESQQEKAQQPASNDANAQ
LLNNIQQMQDQAAIDQFQLNQLQALQQQLPNQDAQSIMLQAQQNQIDQANLQQQLLQQQQ
QQLEAIAQQEQHDNGECQNIEDQSKAQQFSAQVQQEEPVQSTTDAVHQQETNGAVEVDNQ
LQAEQVNQEQQ