Identifiers and Description

Gene Model Identifier

Contig15432.0.g3

Standard Name

KAT7b

Aliases

Contig15432_0_g3

Description

MOZ/SAS family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • N-acetyltransferase activity (IEA) | GO:0008080
  • transferase activity, transferring acyl groups other than amino-acyl groups (IEA) | GO:0016747
  • nucleoside transmembrane transporter activity (IEA) | GO:0005337

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR244W1.0003926095686843e-81ESA1 SGDID:S000005770, Chr XV
from 792531-793868, Genom...
T. thermophilaTTHERM_001457305.997225115851065e-74MOZ/SAS family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15432.0.g3(coding)
ATGGAATAAACTTTGTAACAAGAGACAACTGATTAAGTTCAGGATTAAGAAGAATTATAA
AAAAGCAAAGAAATATAGATTTAGAAGTTAAGATAAAACATAGAGGAGGCTTTCAGGGTG
CTGGATGGAAATCAAAATAAAGATTAATTATCGAAGAGAGATGATAATAATGAATAAATA
TAAGAGTAAGACAATATTCAATCTAAATAAGAAATCACAGAAAAAATAGAGCAAGAATAG
GAACCAGAGGAATATCAGGTTGGATAAAAAATAATGGCTCTTTTATCAAATTAATAACAC
TATATGGCTGAAATAGTTCAGAAAAAGGCTATTGACTTGAAAGAGATTACCAAATTAAGA
CAGAATCATAAGTCAATGCAAAAGTACAAATACTATATACACTTCGATGGAATGGACAAA
CGTTTGGATAAGTGGTGCTTTGACTATGAATTAATAGACCCACGAAGACAAATTGAAGAA
TAAAAATTTAGTGGTTTAAATTCAGACTAGAACCAATTAGAAAATTCTTCCTCAGCAAAA
GCCCTTTAAATTTAGAAACGTGTGACCAGACATGCTTAACGAAAACAAGATGAGATTAAT
CCAACAAATTAGGAATTTCACGATACTAACCCTGAAATCAAGGAACTAGAAAAAAAGCAT
TAGGAGACTACTAAAATCAGGAATATTGAGAAGATTTACTTTGGAGACTATGAAATAAAC
ACTTGGTATTTCAGTCCATATCCCGAGGAATACGGAGAGTAAAGCATACTCTACATCTGT
GAATATTGCTTGAAATATATGCGCAAGTAGAAAACAATTAATGCACATAAGGGGAAATGC
TAGTTTAAAACACCGTCAGGTAAAGTTATTTATTAAGACAAGAAAGTGAAGGAGCTTTTC
AATAAACTAGAAGGTCCAGAGAAAAAATAGACATAAGACGAAAAATAAAATTTGTCTTCA
ATCTCAATTTATCAAATCGATGGCGTTGAACATAAACTTTACTGTCAAAATTTATGTCTC
TTAGCTAAATTATTCTTAGATCACAAGACTTTGTACTATGATGTCTCGCCCTTTTTGTTT
TATGTGATGACTGAAGACTCTAAAGATGGAAGTTCGCACATTGTTGGCTACTTTTCAAAA
GAAAAAACAATGAGTAATGATTACAATTTAGCTTGCATCATGGTCTTACCCCCTTATTAA
AGACGTGGTTATGGGAAATTCCTTATAAGTTTGAGTTATTAACTCTCGATTGATGATGGC
AGGATATGCACACCAGAGAGACCCCTATCTGATATGGGAAAAGTTTCTTATAAAAGCTTT
TGGACTGATACTTTATTAGAAGCACTACTAAAAACTAAAGGAAATATTTCCATCAAAGAA
TTGAGTGAATTCTCTTACATTAAAGTTGAAGACATTATTTAAACGCTCAGTAGTCTCAAT
CTTGTGAGATACTGGAAAGGCCAATATGTTATCACAAATTTCAATGTTAAAATTATAGAA
GAGCACTTCAAGAAGAAAGATGATTAGTGCTTGAAATACCCCAGGAAACCTATCAAGTTT
AAACCTTAATTATTAATTAAATGA


>Contig15432.0.g3(protein)
MEQTLQQETTDQVQDQEELQKSKEIQIQKLRQNIEEAFRVLDGNQNKDQLSKRDDNNEQI
QEQDNIQSKQEITEKIEQEQEPEEYQVGQKIMALLSNQQHYMAEIVQKKAIDLKEITKLR
QNHKSMQKYKYYIHFDGMDKRLDKWCFDYELIDPRRQIEEQKFSGLNSDQNQLENSSSAK
ALQIQKRVTRHAQRKQDEINPTNQEFHDTNPEIKELEKKHQETTKIRNIEKIYFGDYEIN
TWYFSPYPEEYGEQSILYICEYCLKYMRKQKTINAHKGKCQFKTPSGKVIYQDKKVKELF
NKLEGPEKKQTQDEKQNLSSISIYQIDGVEHKLYCQNLCLLAKLFLDHKTLYYDVSPFLF
YVMTEDSKDGSSHIVGYFSKEKTMSNDYNLACIMVLPPYQRRGYGKFLISLSYQLSIDDG
RICTPERPLSDMGKVSYKSFWTDTLLEALLKTKGNISIKELSEFSYIKVEDIIQTLSSLN
LVRYWKGQYVITNFNVKIIEEHFKKKDDQCLKYPRKPIKFKPQLLIK