Identifiers and Description

Gene Model Identifier

Contig14180.0.g37

Standard Name

KAT7a

Aliases

Contig14180_0_g37

Description

MOZ/SAS family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • transferase activity, transferring acyl groups other than amino-acyl groups (IEA) | GO:0016747

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003102402.0009157491910723e-107MOZ/SAS family protein
SGDYOR244W7.999011707514803e-86ESA1 SGDID:S000005770, Chr XV
from 792531-793868, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14180.0.g37(coding)
ATGAGTCAGCGCAAATCAGGAAAAGGCAAAGGCAAGTCCTTCGAAGACATCACCAATTAA
AAATTCAGAAATCCTTCGACTGTTTAGAATGTACAGGAAGAGAATGAATTCCCTGGGGCT
ATAAAGAGAAACACTCTAATCATGGCTAAGATGCGAATGAGTGAGAGTTTTCATATTGCT
AAGATTATTGAAGTCAGAATTGCCTTGGAAGGCGCTAATCAAAGCTTGGAATTATTGTTA
GATGCAGGTGGTATAATCTAAGTAAAACCTCAATAAGACGCAAATGGTTTACCATAGAAT
GAAGATGTAGAGATGCAAGATTAATCAAACTAATCCCCTGATAAATAACAACAGAAACCA
GCTGCAAAGGCTTAAAATTAGAAATTTGAATATTATATCACATATTTGGGTCACTAGAGA
AGAAATGATAGGTGGATTACAGAAGAGGAACTTCGCATTAATGAAGAAGAAATTTAGAAA
GAATTTGCTGCATACGAAGAAAGAGTCAGACAAGAGAAAGAAAATGCTGATTTCTTGTTT
AATGATGAGCATCTAGGATTGAATGAAAAGTAGATTATAGAATTCGAAGAAAGCACAAAA
GTTAAGAGCGTTGAATTTATTGAAATTGGAAAGCATAGAGTTGAAACTTGGTATTTTTCG
CCATTTCCCAAAGAATTTCATTGCAGAACTTTGTACATATGCGAATTTTGCTTGTTCTTT
TTCGTGCATAAAAATGAATTGATAAGACATTCGGAGAGGTGCAAAATTAGATGTCCACCT
GGTGATGAAATATACAGAGATGAATCAGTATCTATGTTTGAAATTGATGGAAAAAATTAA
TAAGCTTATTGCGAGAATTTATGTAGAATAGCTAAATTGTTCTTGGATCATAAGACTTTG
TTTTATGAGATAGACCCCTTCCATTTTTATGTACTGTGTGAGCATGACGCTATGGGTTAT
CATATTATGGGCTATTTTTCTAAAGAAAAGGTTACTATCGAAAACAACTTATCATGTATC
CTGGTAATGCCCTATTGTTAGAGAAAAGGCTATGGTAAATTTTTGATAGAATTTTCTTAT
GAACTGTCAAAAAAGGAATTGCGTAGTGGAACACCTGAGAGACCTTTGTCAGATCTAGGT
CATAGAACCTATGTGAGTTTTTGGACATAGAAACTTCTAAAAATTTTGCTAGATTATGAG
GGAAGACCACTTTCAATTTAAGATTTATCAACTATGACATCTATCACTCATGCTGATATA
ATGTACGTTCTCGAGAATTTTAAAATCCTTCGTTACCACCAAGGAAACTATATATTATAC
ACTGACAAAGAATTCCTGACGCAAATATTAAAAAGTTAGGGACATTTGGGCAGACCAGTC
CACCCAGAGAACATTCATTGGATCCCACACAGCAACAGACCTGAAAAATTTGCATGA


>Contig14180.0.g37(protein)
MSQRKSGKGKGKSFEDITNQKFRNPSTVQNVQEENEFPGAIKRNTLIMAKMRMSESFHIA
KIIEVRIALEGANQSLELLLDAGGIIQVKPQQDANGLPQNEDVEMQDQSNQSPDKQQQKP
AAKAQNQKFEYYITYLGHQRRNDRWITEEELRINEEEIQKEFAAYEERVRQEKENADFLF
NDEHLGLNEKQIIEFEESTKVKSVEFIEIGKHRVETWYFSPFPKEFHCRTLYICEFCLFF
FVHKNELIRHSERCKIRCPPGDEIYRDESVSMFEIDGKNQQAYCENLCRIAKLFLDHKTL
FYEIDPFHFYVLCEHDAMGYHIMGYFSKEKVTIENNLSCILVMPYCQRKGYGKFLIEFSY
ELSKKELRSGTPERPLSDLGHRTYVSFWTQKLLKILLDYEGRPLSIQDLSTMTSITHADI
MYVLENFKILRYHQGNYILYTDKEFLTQILKSQGHLGRPVHPENIHWIPHSNRPEKFA