Identifiers and Description

Gene Model Identifier

Contig1170.1.g38

Standard Name

KARSb

Aliases

Contig1170_1_g38

Description

tRNA synthetases class II (D, K and N)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00152 ) tRNA synthetases class II (D, K and N)
  • ( pfam01336 ) OB-fold nucleic acid binding domain
  • ( pfam01409 ) tRNA synthetases class II core domain (F)
  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam12869 ) tRNA anti-like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006915209.997093137033517e-262lysyl-tRNA synthetase family p
rotein
SGDYDR037W9.997093137033517e-262KRS1 SGDID:S000002444, Chr IV
from 525440-527215, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1170.1.g38(coding)
ATGGAACATAAAAACGAAGACGGTCAACAGCAACCAGCTGCTGATAACAAGAGACAGCAA
TAAAAGGAATATCAAACCAAGGAGGAAGAAGGAAAAACTTTATATCTTGATGAGGTCAAG
AATGAATGGGTCTCAAAGAATGAGATTAAGACCAGAGAAAAGCTCAGAGAAAAGGAGTTA
AAGCTCAAATAAAAGGAAGAGGAGAAGAAGATTAAAGACTCTCAAAACCCAGCTGGCGCT
TCAAAGAAAGCCAAAGAAGTTGAGCTAGACCCCACTCAATACACTGAAAACAGAAAATAA
TTTATTCAGGCAGTTAGAGACAAGAACGAGAACCCATATCCACACAAGTTCAACAGAACC
CACAAACTTTGCGAATTCCATTCTCAATACAACGAGAAATGCGCTCAGAATGACGTCTTC
TTGGAAGACGCTACTGTTGCTGTTGCTGGAAGAGTCATGTCAATCAGGAATGCTGGTTAA
AAGCTTATCTTCATCGATTTACATGGTGATGAGCACAAAATCCAAGTCTTTGCTAACGCT
ACTAACTATACTGCCGAGGGCTTCGATCAACTCTTGCACGCCATCAAGAGAGGTGATATC
ATCGGTGTTGAAGGACAACCAGGCAGAACCAAGACCGGAGAACTTTCAGTCAGACCAACC
AAAATCACCAGTCTCTCATATTGCTTACATCAACTCCCATCTCAACACGATGTTGAAACT
AAAGGTCTCACCAAGGACACTAGATACAGACAAAGATATCTTGACTTGATCATGAACGCT
AGAGTTAAGAAAACATTCAAAATTAGAAACGAAGTTATTGACTTCGTCAGAACTTTCTTG
AGAAAGAGAGATTTCCTCGAAGTAGAAACCCCAATGATGAATATGATCCCAGGTGGTGCT
ACTGCTAAGCCATTCGAGACTTTCCACAATGACCTAAACATGAAACTCTTCATGAGAATC
GCCCCAGAGCTTTACTTGAAAATGCTTATCGTCGGTGGTATAGACAGAGTTTTCGAAATC
GGTAAACAATTCAGAAACGAAGGTATCGATCTCACTCACAACCCCGAGTTCACTACTTGC
GAGTTCTATTGGGCTTACGCTGACTACAACGATCTCATGGACTTCACTGAGTAAATGCTC
TCTGAGATGTGTCTCCAAATTCACGGTTCATACAAGATCTAATATCACCCAGAAGGTGCT
GACAAGAAGGATAACGTTATCGAAATCGATTTTTCACCTCCTTTCAGAAGAGTTCCCATG
ATGAAGGGACTCGAGGAGGCTCTAGGAGTCAAGCTACCAGCTGCTGATCAACTCGGAACT
GAAGAATCAAGAGAATTCTTGGACAAAATTGCCAGAGAGCACGATGTTGAGTGCAAACCA
CCCAGAACCACCGCTAGATTGATCGATAAGCTCGTTGGTCACTTCCTTGAGGTTCACTGC
AAGAACCCAACTTTCATTATTGACACCCCACAAATTATGTCCCCCTTGGCCAAATGGCAC
AGATCTGAAGCAGGTCTCTCAGAAAGATTCGAGCTCTTCATTAACTATCACGAAATCGTT
AATGCTTACACTGAACTTAACGACCCTAAGGTTCAATTCGAAGCTTTCCAAGACCAAGCC
AAGGCTAAGGATGCTGGTGATGACGAAGCTCAAGCCATCGACCAGAACTTCCTCACTGCT
CTCGAATTCGGTCTTCCACCAACTGGAGGTTGGGGTATTGGTATCGATAGACTCGCCATG
CTTATGTCTGACTCAAACAGCATCAAGGAGGTTCTTCTCTTCCCAGCCATGAAGCCAACT
GAGCAACTATAATGA


>Contig1170.1.g38(protein)
MEHKNEDGQQQPAADNKRQQQKEYQTKEEEGKTLYLDEVKNEWVSKNEIKTREKLREKEL
KLKQKEEEKKIKDSQNPAGASKKAKEVELDPTQYTENRKQFIQAVRDKNENPYPHKFNRT
HKLCEFHSQYNEKCAQNDVFLEDATVAVAGRVMSIRNAGQKLIFIDLHGDEHKIQVFANA
TNYTAEGFDQLLHAIKRGDIIGVEGQPGRTKTGELSVRPTKITSLSYCLHQLPSQHDVET
KGLTKDTRYRQRYLDLIMNARVKKTFKIRNEVIDFVRTFLRKRDFLEVETPMMNMIPGGA
TAKPFETFHNDLNMKLFMRIAPELYLKMLIVGGIDRVFEIGKQFRNEGIDLTHNPEFTTC
EFYWAYADYNDLMDFTEQMLSEMCLQIHGSYKIQYHPEGADKKDNVIEIDFSPPFRRVPM
MKGLEEALGVKLPAADQLGTEESREFLDKIAREHDVECKPPRTTARLIDKLVGHFLEVHC
KNPTFIIDTPQIMSPLAKWHRSEAGLSERFELFINYHEIVNAYTELNDPKVQFEAFQDQA
KAKDAGDDEAQAIDQNFLTALEFGLPPTGGWGIGIDRLAMLMSDSNSIKEVLLFPAMKPT
EQLQ