Identifiers and Description

Gene Model Identifier

Contig9894.0.g51

Standard Name

JMJD2

Aliases

Contig9894_0_g51

Description

JmjC domain, hydroxylase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004676901.999129405549486e-73jmjC domain containing protein
SGDYER169W3.9982663658145016e-63RPH1 SGDID:S000000971, Chr V f
rom 523369-525759, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9894.0.g51(coding)
ATGAAATGTGACTAAGAAGCAGGAGATCATGCTATATTTAAGATCATACCACCACCAGGT
TTTAAGGCAAGAAAGGCAGGTTATGACAACCTTGATTTGATGGTTAAAAAGCCTATTGAG
CAAAATGTACATGGCAGCAAAGGTGTCTATGAATTAGTTTATTTTATGAAAGAAAGCAAA
TCCTTAGAAAGGTTCAAGAAATAAGCAATGGAGTTCGACAAACTAATCAATGGAAAGTCA
GATGACGAAATTGAAAAGCTTTTTTGGAGAACATTGAAGCACAGTGCGCCCGTCTATGGA
GCTGATATTTTGGGATCTCTTTTTGATAAAGGAATTGATTGGAACCTCTCTGAAATTTAG
TCTGTACTAACACAAGGATTGGGGTAACATACTATTTAGGGAGTAAATACTCCTTACATT
TACGTCGGATCATGGAAAACAATGTTTGGATGGCATAAGGAAGACATGGATCTCTAATCA
ATTAATTTTATCCACTATGGAAAACCAAAACAATGGTATGGAGTAAATGTGAGTGATAAC
GAGAGATTTGAATAATTCGTAAGAATGAGATTCCCCGAGTATTTTAAGGACTGCCCAGAA
TATATCAGACATAAAACTACTTTGATAAATCCATAAGTCTTAAGTGATTATGGAGTGCAT
GTGACTAAGTTGGTTCATAGAGAGGGTGAATATATGGTCACAAGAGCATCTGGATATCAT
TCAGGTTTCAATCATGGTTACAATATTGCAGAGGCAGTTAACTTTGCTCTGCCAAGATGG
CTAGATATAGCAAGAAACGTTTCAGCTTGTAAGTGCGTTAAGGACAGCGTTTCTTTTAAT
ATGGGCAACTTTTTACTTAACTTTGAGAGATCAGAATTTCTAAAGAAACTATAAAATAAT
CATAAAATGACTAGGAATAGGGTTGTTGAATTTGATGAAACATTAAAAAGGTATGGCCTT
AGTGAGAATCTTCATTCATTCAAAAATACTCCAACCAACATCAAAATTCTCCCAAATGAC
TAGCCAAAGCGAAGTAATAGTTTCATGAACGTTTGTAAATTCGTGAAAGTGTAAAAAGTT
AGCGACAACCCAATGATAGAAGCACGTTCCAACAGCAAAATAAAGTAACACAAGTATTAA
AAACTATTTTATGGGAAAAGAAGTTTAGTGTGCTAAAAGTGTGGGAAGCCAAGGAAAATA
CCCTCAACTCACCCTGATCTAAATGAAAACAATTTTGAGTGCTTGATGCTTAACAATAAG
ATTATCAAGTGTGTAAGTAATCCAGACAACAAAAGGAAAAGAGATTAAAAGTATGAGAAA
AAGAAAGATAGCAGACCATTATTGGCTACATAGTCATAATAAACTATCAATTCACAAAAA
CCTAAATAAATTGACTCAGCTACTTAATCAAAAGATCAGGGTGTTAGAAGAAGGCGAGGG
CAACCTGCAACTCCCCGATAAAAGAACAACAGCTAAGTATCTTAAAAAACAAGGAGATGA


>Contig9894.0.g51(protein)
MKCDQEAGDHAIFKIIPPPGFKARKAGYDNLDLMVKKPIEQNVHGSKGVYELVYFMKESK
SLERFKKQAMEFDKLINGKSDDEIEKLFWRTLKHSAPVYGADILGSLFDKGIDWNLSEIQ
SVLTQGLGQHTIQGVNTPYIYVGSWKTMFGWHKEDMDLQSINFIHYGKPKQWYGVNVSDN
ERFEQFVRMRFPEYFKDCPEYIRHKTTLINPQVLSDYGVHVTKLVHREGEYMVTRASGYH
SGFNHGYNIAEAVNFALPRWLDIARNVSACKCVKDSVSFNMGNFLLNFERSEFLKKLQNN
HKMTRNRVVEFDETLKRYGLSENLHSFKNTPTNIKILPNDQPKRSNSFMNVCKFVKVQKV
SDNPMIEARSNSKIKQHKYQKLFYGKRSLVCQKCGKPRKIPSTHPDLNENNFECLMLNNK
IIKCVSNPDNKRKRDQKYEKKKDSRPLLATQSQQTINSQKPKQIDSATQSKDQGVRRRRG
QPATPRQKNNSQVSQKTRR