Identifiers and Description

Gene Model Identifier

Contig307.0.0.g60

Standard Name

JADE1b

Aliases

Contig307_0_0_g60

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005021209.997975313387782e-28PHD-finger family protein
SGDYPR031W0.000000100009565553302NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig307.0.0.g60(coding)
ATGTTCAATAAATTAAGAAAAGCTTACATACCTCAAATCATTACAAGACTCCAGAAATAG
CATGATGATAAGATTATGAGATAAATGAGGGCCTAAAATTCTCAGGATGTATAAAGTAAC
TCTCAACCAAAATTTGAGCTAAAATTAAGTGACTTTAAAAATATGCCACTTGATGAACTG
ATTGATGATTACTTGACTGAGGAATTAGAACATATAGAAAAATCAAATAGAAAAGACATA
GAGAACATCTTTAAGAAATTTCAAAACAGTTATAGAAATGGGAGAGATAAAGATAAATGG
ATAGATGATCCAACTCTCCCTGAATTCTATTACTAGTAATCAAAGTATTTTATAAAAGAT
ATGAAGCAAAATTATAACTATTACTTCAAAAATGGTAAGAACTTGCTTCTTGACATTTAG
CATTAAAACCTCAATGAAGATAAGATCTTGGAGACTATCTATAAAAAGACTACTTTTAAG
CCACAAGATTATGAAAATTCGAACTTTAGAGATACCATTTTTTCTGATCACTAAGGTTCA
AGAGTATCAAGTCCTAATCCCATGACCCCATCTTAAAAGAGACCTCGTAGTAGTGCTTAC
GGAAAAGACTCAAATCAAACTTAACCAATTGCATAAAATCCTTCTAGAAAAACTAAAAAG
ATTCATAACTCAGCGTAAGGAGATGACGATTGCTGTTTCGTTTGTGGTGATGGAGATTAT
GAAGATGATAATTTAATTGTTTACTGTGGGAAGTGTAATATCTCTTCACATCAAAAGTGC
TACGGCATTGACAACTTAGATGACGATGTTGATTGGATTTGCAATAATTGCTAGGCTTTT
GGCTAAGAAAGTGGATTGAGAGTTTAATGTGCATTATGCATGTAAATTGGTGGAGCTATG
AGACCTGTAAACTATAAGAGAATAGACTACGCCTCAAAGATACATAAAAACAAGTCTGTG
ATGATAGGAAATCCATAGCAACTAAAATAATTTTTTACTGAAGTTGACTATAACATCAGG
TGTTCTTAAATATTGAAGAGAGAAAGTTTGGCTTTTGAGCTAAACAATAGCATTTCAAAC
TCTTAGTCAAAATCTCCCTAACCAGCTGATTAAATTATCAACGAAAAAACTAAAGAAGAA
AGTGGTACTGAGCCTTTCAGATTAAAATTAGAAAGATCTAAAAATTAAGAAAAAATTTAA
ACTCAGTATATCTGGGTTCATTAAAACTGTGGGCTTTGGCAATCATTTTAATGTCCAATA
ATAGAAGTAGAAATGGTGTTTGATGTTAAGTAGTTTGATTACAGAAATTGTCTTGCTGAA
TGTGAATTTTGTAAAAACAAGTTAGAAATCGAGATCAACAGATGTACGCCTAAATATAAA
TGCCAAGAGAGTCAATGCTGGACTAACTTTCATATTGAATGTGCAAGAAGAAACTAGAGA
GTCTTTGAGATTGAATCAATAGAAACAGGTTATAAATTCACACCTATATATTGTAAACAG
CATGAATTTTAAAAGAAAAATAGATATCTGTAAGAAATTAAATAAGCAAAGGAACACGAA
CTAAGTATTTTCGCTAAGAACATGAAGTAATGCCTGAGGAATAATTTTGAAATTAAAGAT
GCAATCGTGAGAAAAGAAATGGGAATAAAATATAAGATGCTATATGAACCAGATACTATC
AAGCCTAAATAAAAAGCCTATTATAATGCCTAAACAGACAAAGGAGATTTGGTCAGGAAA
TGCTTGAGATTTATTTATGAATATAACAACACGAACCAAAGAGCAGCATAGAAAAAGAAA
GGCGACAGTATTGATGAAAAAGCAATTGTTCTTTAAAAATTAGAGATTAAATAAAAGCTT
TAATGGGGATTTATCAGGAAGTAGCTTCCTTTAATAGAATCTTCTTTTAGATACAAGAAC
TTTGATGGACCCTAGGCTTTTAGAGAATTCAAGAAGATTGTTTCAAGTGAGGAAAAATAT
GACCAGCTTTTCGATTTATTTTACTAAGAGACTTAGGCAGATAAAATAATTAGCAAACTA
GATGAAGTTGCATTTTCTTAATCAATCACCGCTGATCATTACTTACTAGGCAAACGCAAA
ATTCTAGAAAAGTAGTAAGTAACACCACCAGAAAGCCAGAAGAAGATTGTAAAGCCTTAA
AAAGTTAAAGAGTAGAAATTTGAAGAAAAATAAAGAATTCTAGAAAAGAGACCTTAAAAT
AATAATATTTAAATGAGTTAGCCTAATGAAAGCATTTTAAATCCAGAAGAAGAAATTTTA
AATTTTGATGATCCCAAACATTTGACATAATAATAAATTCCCCAAAATAAAAATATTCCT
TCAACTCGTAAAAGGGATTCACGTTTGATTAAAGAATATGATGATAGTTTAAATATCGAT
GATGATGATTTGTCATTAAATTCACTAGATTACTATACAGATGAAGACGGATAGTAGCAA
AGAATATACTTTGGCTTAAATAAGAGATTTAAAGCTAATAGGGAATAAAAAGAATATCTG
AATACATATTGGTTAAATCGATAATCCACTACTTCTTCAGAAGAAACTAATGATTTTATT
TGA


>Contig307.0.0.g60(protein)
MFNKLRKAYIPQIITRLQKQHDDKIMRQMRAQNSQDVQSNSQPKFELKLSDFKNMPLDEL
IDDYLTEELEHIEKSNRKDIENIFKKFQNSYRNGRDKDKWIDDPTLPEFYYQQSKYFIKD
MKQNYNYYFKNGKNLLLDIQHQNLNEDKILETIYKKTTFKPQDYENSNFRDTIFSDHQGS
RVSSPNPMTPSQKRPRSSAYGKDSNQTQPIAQNPSRKTKKIHNSAQGDDDCCFVCGDGDY
EDDNLIVYCGKCNISSHQKCYGIDNLDDDVDWICNNCQAFGQESGLRVQCALCMQIGGAM
RPVNYKRIDYASKIHKNKSVMIGNPQQLKQFFTEVDYNIRCSQILKRESLAFELNNSISN
SQSKSPQPADQIINEKTKEESGTEPFRLKLERSKNQEKIQTQYIWVHQNCGLWQSFQCPI
IEVEMVFDVKQFDYRNCLAECEFCKNKLEIEINRCTPKYKCQESQCWTNFHIECARRNQR
VFEIESIETGYKFTPIYCKQHEFQKKNRYLQEIKQAKEHELSIFAKNMKQCLRNNFEIKD
AIVRKEMGIKYKMLYEPDTIKPKQKAYYNAQTDKGDLVRKCLRFIYEYNNTNQRAAQKKK
GDSIDEKAIVLQKLEIKQKLQWGFIRKQLPLIESSFRYKNFDGPQAFREFKKIVSSEEKY
DQLFDLFYQETQADKIISKLDEVAFSQSITADHYLLGKRKILEKQQVTPPESQKKIVKPQ
KVKEQKFEEKQRILEKRPQNNNIQMSQPNESILNPEEEILNFDDPKHLTQQQIPQNKNIP
STRKRDSRLIKEYDDSLNIDDDDLSLNSLDYYTDEDGQQQRIYFGLNKRFKANREQKEYL
NTYWLNRQSTTSSEETNDFI