Identifiers and Description

Gene Model Identifier

Contig14165.0.g66

Standard Name

JADE1a

Aliases

Contig14165_0_g66

Description

PHD-zinc-finger like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004447001.000137892321693e-31PHD-finger family protein
SGDYPR031W9.995317835403734e-19NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14165.0.g66(coding)
ATGACACCCAAAAAGACCAAATTAGAATTAAAAAGAGAGAAACAAATTGAAAAAGCATAC
CGATAGACTCTTAGCTAATATCATTCTTTTGATTGGGATGATCTTAAAGATTTGAAAAGC
AATCCTTATAACTTTGTGAACTCAAACATTTTTTGGTTTCAAGTAAACGCTTCATACTTC
CCATTTAAGAGAAATATTGAACTATATTAAGATCCTGCTAAGTTTCTAACATAAATTAGA
TAAATGACATCATTAGAGACTATTTAATCTTAAAATTTGAAGTGCGATGAATCCAGATAC
AATTTATACTAGAGAATAATTCATGAATTTTCATTAAGAACTCAAAATGAATAGGCTTCA
GATTTTCATGAAAAGTTATTTAATAATGGTCAAAATAACAAAATCTCGGATGTAGATAGG
CTGCTTTAGTTTATGTCTGTCGAATTAATAAGAACAGAGAATGAAATTGGAACTTAATTT
AATGATCTTGAGATAAGTGTTAATAAATCCTATCATCGATCAATCAATGGGAATTCTATT
TTTGATTCACAAGATTTCATCCTCAAGCTATTTGACAATGAAGATGACAGTTTGGATGAA
GAATCTAAAAACATGAAGATACCTCATTAAAGGATAAAGGACTATATCAAATACTCTGAA
GAGAAATTTAATAGACAGAGAGAATTGGAGTTTTGGTAGAAGAAAAATGAAATTCTTAAG
TAAACTAGGACTTTAGTTTCTTCCCCTATCAAGCCATAGATTAATTTGATAACTAGCTCG
TTTAGGAAAATTATGCCAAAAGCTATATCTACCATAAAGGAAGAGCAAAAATTACAATCT
CCCTAAGTAGAGTCTAATGGAGATGAGCAACAAGAGAATTCAGGCTGCGTAATTTGTTGT
GGAGAAGATTATGAAGACGACAATCTGATTGTTTATTGTGAAGTTCACTAAGTTTGCTAT
GGCCTTGAAGTTATTCCAGAAGGAGACTTTATTTGCTAAACTTGTTCTGTATTTGAAGAA
GACTCTCATTTAGTGCAATGCTCTTTGTGTTCTTTAAAAGGCGGAGTAATGAGGCCCACT
CAAACAAAAACATCTGAAAGAATAGGGGATGATAAGAAAGATAAGAAGGATTAAAATTAA
CAGCAAAAATCAATAACTTCTTACTTAAAAAAAGAGAAAGATCTATATAAAAAGAATAAA
ACATTGAAAAATGAAGGTATTCTTCCCCAAGACTTCTGGAACACATACTATTAATGGGTG
CATCTTAGCTGCGTCTTCTGGAATATTGAGTTAATTCTGCCTTAAAAAGCCCCAATCAAA
TTAATTAAATAAAGTGAAAAAAGGTTGAGCTTAGTTTGTGTGATTTGCTAAAAGAAAGGA
GTTGGGGTTTGTATATAGTGCTCCTACAAGAGTTGTCATGTTTCTTTTCATGTTGAGTGT
GCTCGTAAAGCCAAATATTACATGAATTATGATTGTGACACAGAATCAAAGGAAGTATTC
TGTTTATCACACAGACCATTTCCTCTCATTTAAGAGATTGAGAAAAACGAAAAATAAATA
TTCGATGAGATTATGACATTTTCTGAATCTTTTGAGCAATCCTTAGCTGATTTTAAGTAA
CTTAAGAAATGGTCTGACAGAGATCGAAGAGAACTATTATAAAATTGCAGGAAAGTCTAT
TTTTACATGAGAAAATTAAAATGTACTATTTATAAGCAGCCGTAATAATTGCCTGAAAAT
TTGGAATCTCTTAATGATTCAGGTTACTATATAAAAGAAGGAAGATTTTTCGATAGACCT
AAGGATTGGACAGTTTTATAATAAATAAAAGGTGCCTTTCCTTGGAAAAGTGTGATGTTC
AAGAATTATAATCGAAGGGATTGTTTTAGAATGTTTAATGAACTGATTCAAAGTGAAGAT
AGTTTTATTAAAAAGGTTGTCACAGAGAAGTACATAAACTTGTATAACGAGGTAAAGAAA
AGACTTTAAAAGGCTCAATAGAAAGAAAAGATTCGTTAAGATAAAATTTTCTAGAAGAAG
AGATAGTAATAAATGAAAAATAAGATTAAACTTGTTAAAAGATCAACACCACTTTGTTAT
TGCAGAAAACCAGTTATAAAAATCGAAAATGGTATTCTATGCTCAAGGGGTAGAGAAAAA
TGCTTTCAAGGAGGTGTTATACATAAGGCTTGCATAAGAAAGTATGATTCAAGAAATACT
TACTTTGAAGGGCAGAAGTGGTATTGCAAGAAATGTATTGAGTATCTCAGGTTTAAATAA
ATCTAAAAAGCTTAATCATAGTAAGACCTTGTTGGATCAAAAAGAAAGAAGCTTGATTAA
TCCCATTCAAAATACTCAACGACCAAGAGAAGCAATAGCTAGAAATATTACTCATCTAAC
AAAGACCCACTCACTAATGTAAATACAAGTGAAAATCAAACTTGCGAGCAAAGTACTTCT
TTTCAATCGAATAACATCATGAGTGATTAATTCCAATTATCTGCAACTTATGTGCCTATG
CAATCATAATCCTAAAATTACACGTTTTAAAGCAATGTGAACAGTTAAAGTCACTCATAA
AATACACTTGATATAGTAAAAGATTAAAATTTAACGAAAATTAGTGATCTAGGTGCAAGC
CAACAAATATTTAAGAACTCAAAATAACAACAAGACTCAATGAAAACTGAAATATTTGCA
TTATAAGAAGAGAGTTCATGTTAAAATGAGCATGAGAATTACATAATTAAAGCTATTTTT
AGATGA


>Contig14165.0.g66(protein)
MTPKKTKLELKREKQIEKAYRQTLSQYHSFDWDDLKDLKSNPYNFVNSNIFWFQVNASYF
PFKRNIELYQDPAKFLTQIRQMTSLETIQSQNLKCDESRYNLYQRIIHEFSLRTQNEQAS
DFHEKLFNNGQNNKISDVDRLLQFMSVELIRTENEIGTQFNDLEISVNKSYHRSINGNSI
FDSQDFILKLFDNEDDSLDEESKNMKIPHQRIKDYIKYSEEKFNRQRELEFWQKKNEILK
QTRTLVSSPIKPQINLITSSFRKIMPKAISTIKEEQKLQSPQVESNGDEQQENSGCVICC
GEDYEDDNLIVYCEVHQVCYGLEVIPEGDFICQTCSVFEEDSHLVQCSLCSLKGGVMRPT
QTKTSERIGDDKKDKKDQNQQQKSITSYLKKEKDLYKKNKTLKNEGILPQDFWNTYYQWV
HLSCVFWNIELILPQKAPIKLIKQSEKRLSLVCVICQKKGVGVCIQCSYKSCHVSFHVEC
ARKAKYYMNYDCDTESKEVFCLSHRPFPLIQEIEKNEKQIFDEIMTFSESFEQSLADFKQ
LKKWSDRDRRELLQNCRKVYFYMRKLKCTIYKQPQQLPENLESLNDSGYYIKEGRFFDRP
KDWTVLQQIKGAFPWKSVMFKNYNRRDCFRMFNELIQSEDSFIKKVVTEKYINLYNEVKK
RLQKAQQKEKIRQDKIFQKKRQQQMKNKIKLVKRSTPLCYCRKPVIKIENGILCSRGREK
CFQGGVIHKACIRKYDSRNTYFEGQKWYCKKCIEYLRFKQIQKAQSQQDLVGSKRKKLDQ
SHSKYSTTKRSNSQKYYSSNKDPLTNVNTSENQTCEQSTSFQSNNIMSDQFQLSATYVPM
QSQSQNYTFQSNVNSQSHSQNTLDIVKDQNLTKISDLGASQQIFKNSKQQQDSMKTEIFA
LQEESSCQNEHENYIIKAIFR