Identifiers and Description

Gene Model Identifier

Contig72.0.g4

Standard Name

IWS1c

Aliases

Contig72_0_g4

Description

TFIIS helical bundle-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08711 ) TFIIS helical bundle-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004393000.000000000003998907168546896hypothetical protein
SGDYPR133C0.00000000006996681903814525SPN1 SGDID:S000006337, Chr XVI
from 797210-795978, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig72.0.g4(coding)
ATGAAAGTTAAAGGTAAATTAAACAAAACTAGTAGCATTTAACCAAAATAAGAAAGTCCC
ATAGATTAATAAGACGATAATCAAAATTAGACACCAAATTAACCTGACAAGGATCAAGAA
GATAGAGGCAATTAAGTGCTAGTCAAATCTGAATTTGGACTGGAAGCAGGAGGTGTTCAG
GAGAATCATCATAAATCACGTAAAAGCAAGAAAGCTTCAAAGAAAGAGAAGAAAAGTAAG
AAATCTAAGAAAAACAAGAAGAGAACCAAGAGAGATCACGATGATTACGAGGATGGAGAG
TAGGGCGAAAACGAAGAACAGGTTAAACTGGCAAAGAAAAGAGTAAAAACTGAGAGAGAT
CAAGGTCAGTATAATTATGATAATGATTCAGAGAAAGAACTCAATGAAGATGAGATAAAT
ATTAGAGAACTTGAAAAGCAAATTGAAGAGCTGAAACAGGATTGCGATCTTCAAGATCAG
GTGATAGACTAGAGAGGAGGTGTAGGTGAAATCTCTACTAATGCAGAAAACAATGAAGAG
GATTAAGACTAAAATGATGAGAACATATCGAATGATGAAGCTGACAAGTACACTCCAACT
GCAATTAACACTACTCAAGTGGTGAAAACTGAATTTAAGAAGAGGATTGAGATCAAGAGC
ATACCCACCATTAATGTCAATTAGGCTAAATCTAAAACCAAGAAGGAAGAGAAAATGCTT
AAGAAGTTGGAGGAGGAAAGAGCAGAACAAGAAAAACTTAAGAAATACAACGATTAACAG
AAGGAAATCTATCAAAAATTCAAGCAGCAGGATCTCTAGAAGTAGCAACGTAGATAAAAC
GCTTATAATAACAACGAGGAAGATAATTTGACTACTGAAGTTGATCAATTAATAAGAAAA
ATGAAATGTGCTATTGAACAGGATAAACTGGCTTGTATAAACAAGGCACCAGCTGTTTTT
AGATTATAAGCAAGCAAAGAATGCTACAATTTAATTCATAAGCTTCCAGTTCAAGAGAAA
TTCTTGGAATAAAATGGCTCACTTTACATCGCTTAATGGCTTGACATCATGCCAAATGGA
CATTTCCCCAATGTAAATCTAGTTGAAGGAATGTTAAAATGCATAGATGGAATTAGGTTT
GATGAGGAGCATCTGCTTGAGTCAAATTTAGGTTAAATCTTACAGTATTACTCTGAAGGA
ATAGCAGAGACAAATTTACAAGTGAAAAGATTAGCGAAGTCTATACTTGAGAAATGGTTC
AGATCCATCTATAAAATTCAATCTAACTACGATTAAGACCTAGAGTTTGATAACAACTAC
AAAGAATTCCAGAAGAAAATTTTGAAGCAAAAAAAGCAAATCAAAAATCAAGACGATTAG
GAGAGCGATGATGATGCTAAAAGGAAGTCTAAGAAGTCAGAAAGCACGAAATCAAAGTCA
AAAGACATGTAGAATTTCATGAAAATCAGTAATTAGAGCACTCGAAATAACAACCCGTTT
CCTGTTTTACTACCAGAGAGGAATGCTTTTGATTTTACGAAAAGACCTGAACGTAGAGAA
GAGGCAACTTACAATAAAAAGAAGGAGACTGATAGTGGCAGGTACAAAATCAAAAGGATT
TTAGATACTATGAAGAAAAAGAATGAGTAGAGTAAGAAAATTGGGAATGGGTTTTAAGGG
TATGAACAGGCCGATTATTCTTGA


>Contig72.0.g4(protein)
MKVKGKLNKTSSIQPKQESPIDQQDDNQNQTPNQPDKDQEDRGNQVLVKSEFGLEAGGVQ
ENHHKSRKSKKASKKEKKSKKSKKNKKRTKRDHDDYEDGEQGENEEQVKLAKKRVKTERD
QGQYNYDNDSEKELNEDEINIRELEKQIEELKQDCDLQDQVIDQRGGVGEISTNAENNEE
DQDQNDENISNDEADKYTPTAINTTQVVKTEFKKRIEIKSIPTINVNQAKSKTKKEEKML
KKLEEERAEQEKLKKYNDQQKEIYQKFKQQDLQKQQRRQNAYNNNEEDNLTTEVDQLIRK
MKCAIEQDKLACINKAPAVFRLQASKECYNLIHKLPVQEKFLEQNGSLYIAQWLDIMPNG
HFPNVNLVEGMLKCIDGIRFDEEHLLESNLGQILQYYSEGIAETNLQVKRLAKSILEKWF
RSIYKIQSNYDQDLEFDNNYKEFQKKILKQKKQIKNQDDQESDDDAKRKSKKSESTKSKS
KDMQNFMKISNQSTRNNNPFPVLLPERNAFDFTKRPERREEATYNKKKETDSGRYKIKRI
LDTMKKKNEQSKKIGNGFQGYEQADYS