Identifiers and Description

Gene Model Identifier

Contig8878.0.0.g56

Standard Name

IWS1a

Aliases

Contig8878_0_0_g56

Description

TFIIS helical bundle-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08711 ) TFIIS helical bundle-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004393004.0002685161515803e-16hypothetical protein
SGDYPR133C0.00000000019994075865167896SPN1 SGDID:S000006337, Chr XVI
from 797210-795978, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8878.0.0.g56(coding)
ATGAGTGACTAATTACACGAAGAGAACGACCTTAGTCTCCAAGATTAAGAACGCCAAATC
GTCATTTCTAGTCCCAATGGTAAATTCCATTAAATGTTGCCAAAAATCAACCAAATCGAT
ATAGAGTAAGAAAGCCTGGATAATTTGAATGAAGATGAGGGATAGCAACGCTTACATAAA
CATCACAAATCCTCTCATGAGCACAAGTCTAAAAAGAATAAGAAACACAAGAAAGATAAA
AAATCAAAAAAGCGTAAGCACAGAGACCACGATGATGCCAACCAAGAGTAGCTCTAAAAC
TAAGACGAGTCTAACCTCCCACCTGATTAACCCGAGTAAAACTAGGACGAAGAAGACATC
GAGGCAGAGCTAGCCAGGATCCAAGCAGAAATTGATTAATTGAACTAGTAAGGTCCAAGC
CAAAGACTAAGAAAAAATGAAGCAAGCCTCGATGAAGATAATGAAGGAGTTGTTGGTCTC
TACTCTGACGACGAAGTGGAAGATGGGAAGGCAAATAAAAAATCAGAGAGAAAGAGACTA
GCTAAAATCAAAATGATGGAGTAAAAGGAAAAATAAAGGTAGAAAATGAAGGAAAAGCAA
CAAGAACTGGACGCCTAGAGAAAAATGGAAGAGGAAAAACTTGAAAAATATAACGAAAAA
CAGAAAGAACTTTACCTAAAAATCAACTCTAAAACTACTAAGCAATCTCAAAAGAGTAAG
CTAAATGGCGACGAGATCGACTTGAAAGAGGATGAAATAAGTAGCAACGATGCCTAGAAC
CTCATCGATAGAATGCATATGGCATATATTCTCGATAGAGAGGCAATTGAACAAAAAAAG
CCAGGTCTTAAAAAGCTCTTGATGGCCAAGGAGGTCTACGAGACTCTAAGAAAGTTAGGC
GTCTAAGAGAGATTCTTGGAACTTGGTGGTTGCAGAGTACTTTCAGAGTGGCTAGACATG
CTACCAGACGGAACTTTCCCAAACTTCAACTTAGCATAAGGCATGCTTAACTGCATCTTA
ACGTTAAAGATCGACAGTAACTAACTTGATGAGAGTAATCTTGCTCCCACAGTTTAGTAC
TATGAAGTTGGTGCAGCTAAAATGCCTGAGCTATAAAGACTAGCAAAGTAAATTATCGAT
AAATGGTCTCGCTAACTTTACAACATCCGTTCGAGGTACGATGCCGATGGTTAACACGAT
GCATAGTACAGATAGTACCAGCTTAAGCTTCATGCCCAAAAAGAAAAGCAGCAACACATA
AATCAATAAATTGAGAAGCTAGATAAAAAGGGAGATGGAGATGAGGACTTTTCAGACGAT
GAATTAAATGGCAAAAAAGGAAAATCTGCCTCACAATAAGACGACAAAAAATCAATCTCT
CGTGGAAGAACGGGTATTATGCTTCCTGAGAGAGCAGCTTTTGATTTTGTCTACCCTCCT
GATGCTAAATCAGTAAATGCCAAAGCCAGAAAGAAGGAAAATGAAAGTGGCAAGGCTAGG
TTGCAAAAGACTCTATTGTAACTTAAGAAATCTAACACTAAATCAACGACCTCATCAAAG
GGTATGGCTACTGTCAAAATTAACTATTGA


>Contig8878.0.0.g56(protein)
MSDQLHEENDLSLQDQERQIVISSPNGKFHQMLPKINQIDIEQESLDNLNEDEGQQRLHK
HHKSSHEHKSKKNKKHKKDKKSKKRKHRDHDDANQEQLQNQDESNLPPDQPEQNQDEEDI
EAELARIQAEIDQLNQQGPSQRLRKNEASLDEDNEGVVGLYSDDEVEDGKANKKSERKRL
AKIKMMEQKEKQRQKMKEKQQELDAQRKMEEEKLEKYNEKQKELYLKINSKTTKQSQKSK
LNGDEIDLKEDEISSNDAQNLIDRMHMAYILDREAIEQKKPGLKKLLMAKEVYETLRKLG
VQERFLELGGCRVLSEWLDMLPDGTFPNFNLAQGMLNCILTLKIDSNQLDESNLAPTVQY
YEVGAAKMPELQRLAKQIIDKWSRQLYNIRSRYDADGQHDAQYRQYQLKLHAQKEKQQHI
NQQIEKLDKKGDGDEDFSDDELNGKKGKSASQQDDKKSISRGRTGIMLPERAAFDFVYPP
DAKSVNAKARKKENESGKARLQKTLLQLKKSNTKSTTSSKGMATVKINY