Identifiers and Description

Gene Model Identifier

Contig14192.0.g84

Standard Name

ISY1

Aliases

Contig14192_0_g84

Description

Isy1-like splicing family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005889101.9993430003514377e-39Isy1-like splicing family prot
ein
SGDYJR050W0.0000000000019997478866288316ISY1 SGDID:S000003811, Chr X f
rom 528697-529404, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14192.0.g84(coding)
ATGAAACGCTCTCTGAACGTAAAATAAAGAGAGAAACGCCCTGAAAATCCTTAACACTGC
ACCACTGTTTCAGATTGCGAATAATGGCGATAAAGTATTGTGAGAGAGCTTGTCAGGAAA
GTCTCTGAAATTTAAAATGCAACTCTGGGTGAATTTCGTATCAGAGATCTAAATGATGAG
ATCAATAAGCTGATTAAGGAGAAAGAAAAATGGGAGGAGAGAATCAGAGATCTTGGTGGA
CCAGACTATAGATTGCAAGCAAATAAGCTTCTTGATACTGAAGGATCAGAGCTACCTGGG
GCTGATGGTTATCGTTACTTCGGTGCTGCAAAAAATTTACCAAAAGTCAGGGAACTATTT
CAAAAAGAGACACCTTCTGCCCCTAAAATAAGCAGAGTTGATCTTTATAAGAGAGTGACC
TACAGCTACTTAGGCTATGTATAGGATATGGAGTTGGAAAGAAAAGAGTAAGAGTATGAA
GAAGTATTAAAAGCAAAGTATTTGGAATCATTGTCGTAGAAGAGACAAAAGACTGAAGAG
ACAAATGCTTAGTTTGGAGTCGGTGAAGAATCTTAAATAACTTAGCAAGAAAAAGTTAAT
ATCGAGAAATTCAAGTAGCTACATTCGCTGAAATTGAACATGTTATATCCCTCAGAGCAG
ACTAAGTCTAAAAACTTAAGAATTATTGACGAAGAAGATTTTAAGGGTTATGATGAAGAA
GGAGAGCAAAACTAGAACCTTGAAGAGGAGCAAGAGTCTAAATTGATGGAAAATATGTAG
GGTTAATAAGCTTATTAAGCTAGAACAAAGGAAGATCTATTGAAAAAATTAGCAGATAAA
AAGAAGGAACTTCTCATGAAAAAATATGCTTCGGATGCCAATGTGGATCAAAGTTAAAAC
ATGGTCAATGATTTAGATGATTGA


>Contig14192.0.g84(protein)
MKRSLNVKQREKRPENPQHCTTVSDCEQWRQSIVRELVRKVSEIQNATLGEFRIRDLNDE
INKLIKEKEKWEERIRDLGGPDYRLQANKLLDTEGSELPGADGYRYFGAAKNLPKVRELF
QKETPSAPKISRVDLYKRVTYSYLGYVQDMELERKEQEYEEVLKAKYLESLSQKRQKTEE
TNAQFGVGEESQITQQEKVNIEKFKQLHSLKLNMLYPSEQTKSKNLRIIDEEDFKGYDEE
GEQNQNLEEEQESKLMENMQGQQAYQARTKEDLLKKLADKKKELLMKKYASDANVDQSQN
MVNDLDD