Identifiers and Description

Gene Model Identifier

Contig390.0.g93

Standard Name

ISXO2L9

Aliases

Contig390_0_g93

Description

ISXO2-like transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam12762 ) ISXO2-like transposase domain
  • ( pfam04889 ) Cwf15/Cwc15 cell cycle control protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig390.0.g93(coding)
ATGCTCCGTTATCACAAAATTCCAATATAGTATAAAATCCTGAGTTTAATCTCAACTAAG
AAGATACAGAATCAAAAGATAACTAATAAGATCCAAATAAGCCAAAGCCAGAGGAAAAGA
AAGGGAGGAAAGCTAGAGTTAAGCTTCGATTCTACTTTTGTTTGGTGTCAATAAAATGAG
TTAATAAAATCACTTCCAGAGTGCCCATTCTGTGAAATACCAATGAGAGTCTCTATAAAC
TCGACAAATATTCATGATGCCAGGGAGTATACTTGTCATAACAAATGCGGTAAAACTATA
ACAATTAGAGAGGGAAGTTTCCTGGACGAGTTTAAATGCACTTTGATGGAGCTTATCAGA
ATCATTTTCTATTACTACTGCAGAGGATATATGGTTGAGACTGTTCACAAAGAATTAGCC
TTTGGAATATCAAGAACTGGTGGAATTGACATGTCTAAGTAAATGATCTTAGGTATATAC
TCTTTTATGAGAGAAATAATATCAGATAAAGTTGTGAGAGATATCAAGAAATAGAAGTTG
GGAGGAGCTGGAAAAGAAGTATGGATGGATTCATATAAGCTTAATCTCAAAACTAATTCA
GGAGTGGAGGAATTTTGGATAGTTGGTTTTATTGAGAAGACTAACAATAGATCTAGAGCA
TTTCTTACTAATGATATAAAAGTAGACACTATAGCTCTATTTATAGCTAAGACAGTTGCC
AAGCATTCTACTTTGTGTACACCTTATTATCATTAAGTAGGGTGGGAATTCTTGGATAAA
TTTTACGATCATTAAAGATTAAGAAAAGATAAGAATGAATAGAAAAAAGGTTCAAGAGGA
ACCAGAGTACTTAGCGGATTCGAATATATGTGGTCAGAAATTAAAGAGTTAGAAATAGTT
TTTATGAAACTGGGCGAGAAAACTCGAAGGCTGAAGAGAGTCAAAGCTCATTTGCAGTGC
TATCTTGATGAGATGGTTTGGAGAACCCAATGCAGGACTCTGGATGAAAAACGTGCATAC
TTATTGAAAACTCTCAATTTTACAGAATGGCAAAAGTATGTAAAGCGATTGGAAAAGCTT
TCCAAAAAGAATCAGAAAACCGAGGCAAAAAATGTTGCTGAAGAAATGATGATGGAAATG
GAGCAAGAATAAAAAAAGCGTAAGAAACTTAAGAGAAAATATTCTGACACTTTGGACGAA
GATGACGAAGACGATCCATTAGAAGAGAGACGAAGAATGTTTGGTGAAGAGTCTCAGGAT
AGCGATGATGATGGTAATTAGAGCGACGATTCTCTTGGGAATGCTTAAGAAGAAGAGGAA
GATGAATTTATGATTGTTTTGTAAGCAGTCAGAGAACGGAAAAAGAATGAGGCTGAAAAC
GGAAAAACACTACTCAAGGATAAGTTAAGTTAGACTGGTTGGAAGTTGAGAGAAAATTTT
ATGAAAAAATCTAATGCTTATTTGGACGAAAAAGATCGTATTGATGTGTTTAATGGGGCA
CCAATAATAGAAGAAAAACCTAAAGAAGAAATTGATGATGGAGAAGATGTAATTATTCTT
GATTATTGA


>Contig390.0.g93(protein)
MLRYHKIPIQYKILSLISTKKIQNQKITNKIQISQSQRKRKGGKLELSFDSTFVWCQQNE
LIKSLPECPFCEIPMRVSINSTNIHDAREYTCHNKCGKTITIREGSFLDEFKCTLMELIR
IIFYYYCRGYMVETVHKELAFGISRTGGIDMSKQMILGIYSFMREIISDKVVRDIKKQKL
GGAGKEVWMDSYKLNLKTNSGVEEFWIVGFIEKTNNRSRAFLTNDIKVDTIALFIAKTVA
KHSTLCTPYYHQVGWEFLDKFYDHQRLRKDKNEQKKGSRGTRVLSGFEYMWSEIKELEIV
FMKLGEKTRRLKRVKAHLQCYLDEMVWRTQCRTLDEKRAYLLKTLNFTEWQKYVKRLEKL
SKKNQKTEAKNVAEEMMMEMEQEQKKRKKLKRKYSDTLDEDDEDDPLEERRRMFGEESQD
SDDDGNQSDDSLGNAQEEEEDEFMIVLQAVRERKKNEAENGKTLLKDKLSQTGWKLRENF
MKKSNAYLDEKDRIDVFNGAPIIEEKPKEEIDDGEDVIILDY