Identifiers and Description

Gene Model Identifier

Contig2419.0.g102

Standard Name

ISXO2L7

Aliases

Contig2419_0_g102

Description

ISXO2-like transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12762 ) ISXO2-like transposase domain
  • ( pfam10303 ) Protein of unknown function (DUF2408)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2419.0.g102(coding)
ATGAACGAAATATTGACAACTCCTATTATCATGACTATCTATGGAATGATGAAAGCTGGT
TTATTACATTCAAGAAGAGACTGTCCTATGTGTATGGGGCGAATGCTTTTCAATAAAGAT
ATGATAGCAAATGCCGATTACAGATGGACCTGCTCTTTATGTTTTTACTCATTGGAACTT
ACCACATCGACACCTCTTAATGGCATCAAGTTAGATGAATTCGATCTTTTCTTAAGGATA
TGGTCAGAAAGTAGTGCACTTAAAATCACTTAGATATCGAGTGTTCTGCGTACTTCACAC
TCTAAAGCACATTAAAAAATTTACAGATTTAGTATGGCTCACTATTGGGCAAGATACATA
AAGCCAAGTTTAAGACTTCCAGGAGTCGTTGAAATTGATGAGACTATGTCTAGTGCCAAG
AAATATGCTGTTGGAACTAAATTCCCTCATTAACGTTGGATATTTGGCATGTATTGCAGA
GACACTCATATTTGTGTTATGTACAACATCAAGAACAGAAATCATTGGAACATTTATCCT
CATTTAAAAGCCCATATAAACCCTGGAGGAGTTGTGGTTAGCGATGAACATGCAACTTAT
GTATGTTTACAGAGTGCGAAATCCAGATTAGCTTAATTTGGTTGGTATCACTTTTGGGTT
GTGCATTCCTCTGGGTACTCCCATGAAAAATTTCCATTTTTGTTCACTTCAAATATTGAA
GCAACTTGGGCAAAACTCAAAAGATAAAATACAGGTCTTAAGCAAATGAATACTAAGAAA
TAAATTGAAAGTTATGCAGATTAATTTTGTCTTAGGTATATCCTAAAGAAAGACAAAGTT
TACCCTTTTGCCTTAAAGACTATTCGAATATACTTTGACGATATGGTCTAAAAGTTTAAG
CAGCTAACGAACTATGAGGAGTAATTTTACCCCTGTGCTGGTGCCCTAGAATTTTACTGT
GACTCTATAATCAAGGAGGGTAATGAAAAAATAATGAAAGTTTTTAATTGTGAAAACTAT
CACGATCGTTAGTACATGAAGCTTTTCAAAAATTACGATGCAGATTAAATTCAAAGGGCG
GGAAACTTAGAAGGTGTAATAGATCCAACTGTACTTTATTATGTAGAGCTTGAAAAGCAA
AAATAAACCAAAATCAATTAAGTAAAAAATGTACTACTGCCTATTTGCTATGACTTGTGT
GCTGACATAGAAGAGAATCCAGAGGAAGAACGTAAAAAAGATAAATAAGCTACAGACGCC
TACAAATAAATAGATATTAGCACAATTAAATCACTTGGTGATTTGGGATTTGCAAGGCGG
GTGCACGAAAAAGCATCAGAAAATGCGATTTGTGTAAATTATGATAAGATGAGAAGACCA
GGATTCACCATGCAAAAATACTTAGCTACTTGGTGA


>Contig2419.0.g102(protein)
MNEILTTPIIMTIYGMMKAGLLHSRRDCPMCMGRMLFNKDMIANADYRWTCSLCFYSLEL
TTSTPLNGIKLDEFDLFLRIWSESSALKITQISSVLRTSHSKAHQKIYRFSMAHYWARYI
KPSLRLPGVVEIDETMSSAKKYAVGTKFPHQRWIFGMYCRDTHICVMYNIKNRNHWNIYP
HLKAHINPGGVVVSDEHATYVCLQSAKSRLAQFGWYHFWVVHSSGYSHEKFPFLFTSNIE
ATWAKLKRQNTGLKQMNTKKQIESYADQFCLRYILKKDKVYPFALKTIRIYFDDMVQKFK
QLTNYEEQFYPCAGALEFYCDSIIKEGNEKIMKVFNCENYHDRQYMKLFKNYDADQIQRA
GNLEGVIDPTVLYYVELEKQKQTKINQVKNVLLPICYDLCADIEENPEEERKKDKQATDA
YKQIDISTIKSLGDLGFARRVHEKASENAICVNYDKMRRPGFTMQKYLATW