Identifiers and Description

Gene Model Identifier

Contig19130.0.g71

Standard Name

ISXO2L5

Aliases

Contig19130_0_g71

Description

ISXO2-like transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19130.0.g71(coding)
ATGGATTTTCAGCAATTGCTTTTAGAATATAAATTCAAGACTACAGAGAAAAAGAAAGGT
CAATTCTGGTGGAAAGAATAAGCTTGGAACAAGACTGATCATAAGGTCAAAGTTAGAAAA
GAGAAAGTTGAAAGATCATTCTAGAAATCAGATTATGTCCTTTCGATATCTGGGGGTTTC
GAATCTTGCTTCAGTTGGCTAACAGGAAATAATGTGCTTAATGGTCTGCCAGTTTGTGAA
GTTTGTTGTGCAGAAATGGAATTAGGGGGTTCAGGTCAACGTTGCTCTATGGATCCAAGA
AGTTACAGATGCAGGACTTGTCTAACCAAGGAAAGTATCAGACATCGTTCTTTTGTCAAG
GATGCTCATTGTACACTTATGGAATTCGTGAGAATAAGTTTCTACTACTTCTTGAAAGGG
TATGACCCAGATTTAGCTCACAGAGAAATGACTGAAAATGCTCATGATGGAGTTGGAGCT
GGGATTGCAAAATCATCAATTTATAGTGTCTATGCACTGTGCAGAGAAAGGATATCTAGA
CATGCTATGTTCTCTGTAAATCATAAGAAATTTGGTGGACCAAAGAAGGAAGTTCTGGTT
GATTTCCTTAAGCTTCATCTCCGCAATAAGTAGGGCAGATCAGAGGAGTGGCTTGTTCTT
GGATTTATAGAAAGGATCAGTGGCAGATGTCGTGGATATATGATTCCTAACATTAAGTAG
TAAACCATAGTCCAATACTTAGCAAAGACTGTTGCCAAGGAATCAGTGCTCTATACACCA
TTCTATTCTGAAACAGGTTGGGAATTCTTAGATAAGTTTTTCGATCATAGGAGACTTAGG
AAGACTAAATCAAATGACTATTTTACTGAAACTTAGCATTGGCTTAAAGAATCAGGGTTT
GATAAAATGTGGAGAAATGTAAAAGAACTCGAAATGAGTTACTTAAAATTTCAAACTAAC
ATGAGGAGATATGGTAAAGTTCATGAAAATTTGCAGATGTACATCGATGAACAAGTTTTT
AGGACTGAGAATAATACTTTAGAAGAAAAGAGAGAAGCCTTATGCTAGGCTTTTCACGTT
GACCACTGGAAAGAGCAAGAAGAAAATAAAGATAATGAACTAGGTATTGGAGGAGGATAT
GGCTAGTTTGGTATACTAAAAGAAGAGGAGTTCTTGAGATTATTGAAAACCAGTGGAAAA
AGAGTGTAAAAGTTCCATGACCACCCTGATGAATATAAGAATTAATTCTACAAGATTAAG
TATCCTAAAAAGGACGATGGTACGAGGTTGGTGGTCTCGAATCAAGAAGGAGTTGAAGAG
GATGGAGGGGTTGAGGGTGTTGACATTGATATGCCCTTCAAAAAGTTAGCAGGAGAGCCA
GAACCAGAATTGGATATCTACGACATTGCCAAGAAAAGATTTGCAATAGATAAAGAGTAA
GTAGTGACTAAAATTTAACAAGAACTTATGGAGTTACAAGATAAGGAAATTCATCCTGAA
GATTTATTTTGA


>Contig19130.0.g71(protein)
MDFQQLLLEYKFKTTEKKKGQFWWKEQAWNKTDHKVKVRKEKVERSFQKSDYVLSISGGF
ESCFSWLTGNNVLNGLPVCEVCCAEMELGGSGQRCSMDPRSYRCRTCLTKESIRHRSFVK
DAHCTLMEFVRISFYYFLKGYDPDLAHREMTENAHDGVGAGIAKSSIYSVYALCRERISR
HAMFSVNHKKFGGPKKEVLVDFLKLHLRNKQGRSEEWLVLGFIERISGRCRGYMIPNIKQ
QTIVQYLAKTVAKESVLYTPFYSETGWEFLDKFFDHRRLRKTKSNDYFTETQHWLKESGF
DKMWRNVKELEMSYLKFQTNMRRYGKVHENLQMYIDEQVFRTENNTLEEKREALCQAFHV
DHWKEQEENKDNELGIGGGYGQFGILKEEEFLRLLKTSGKRVQKFHDHPDEYKNQFYKIK
YPKKDDGTRLVVSNQEGVEEDGGVEGVDIDMPFKKLAGEPEPELDIYDIAKKRFAIDKEQ
VVTKIQQELMELQDKEIHPEDLF