Identifiers and Description

Gene Model Identifier

Contig18522.0.g12

Standard Name

ISXO2L4

Aliases

Contig18522_0_g12

Description

ISXO2-like transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12762 ) ISXO2-like transposase domain
  • ( pfam03506 ) Influenza C non-structural protein (NS1)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18522.0.g12(coding)
ATGAATACTATAAACTTACTGCTTTTTGATTTTGCTCTTGCTATGTGGGTAAGAAATGCT
ACTCCAAAGATGGCTGGAGATATGAGTAGTGGAGGTCATTCATTGCAGGCTTAGTTTATG
ATATTTAGAAGAGCCTACACATTCTTCATGAAAACTAAAGTCTTACCTTACTTAGTTTTA
CCAGGACCAGTTGAAATTGATGAAGCTAAAATTGGGAGATAAAGGTGGCATTTCAGAGGA
GAATTTCCAAAAAAAATCAAGTGGGCTTTTGGAATGTTTTGTAGGACAACCTAAATACCA
GTAATCTACGAGATTAAATGCAAAGTACATGCTTATTTAGTTTCGATATTAAAAAGACAT
TTGAGAGCAGGTACAGTAATGCATTCGGATCATCATTCTTCATATGTAGTTTTGAGATCA
GCTAAAAGTTTACTAGCAAAATATGGTTTTTATCATTACTGGGTAAATCACTCCAATTTA
TATGTGCATGAAAAATTCTCATTTGTAATGACAGGAAACATTGAAAGAGTTTGGAGTTAA
TTAAGACATATGATGATGCCTTTAAAATTTCAAAGAAACTCAAAAAGAATAGAGGAGTAT
CTCTGCACTTATATGTTACAATAAATGATTAAAAATAAGTAAAGAGAGTCTTGGACTTTA
AAGATGCTCAGAGATTTCTATAAACATTAATATTACATCTATATTAAACTAAGAAATGCA
GAGGAGGATAGAGTCCCAGGTTTACGCTCAATTGAAGAGGCTAATTCTAGATTGGAAGAA
CTGGGAATGTTTTTTCGAGACTATGAGGCGGAGTATCATGCAAAGAGTTTGCATCATTTA
ACTCTTTTTAAAAATGAAGACCTAGATGATGTAGTGAAGCCTTTGACTACTTAAGATATA
GACCCCTCTATTTAAAATTTAAGATACGACCCACATAAGCATATTTTCATGACTCATAAA
TCAAGGGATGATATTGTCATGCATTTAGATCCCAGAGAAGACAAAATACTAAGATTACAA
TACATTAAATTTTATGAAGAAGACAATGGAGTTGGTTGGTACAAAAAACCTCAAAATTAA
GAAGTAAAAGAATAAAAGGAAATTAATCCAGATATTTTTAGCATTTAGTCTGGGTCAAAT
TATCGTATACAATCAAATTTTGTAGATTTGACTAACGATTAAGAAGCTCAAGATAAAAAC
AAATAAAATAATCATAGTTAAAAAGCTGATAATTAAATTTCAAATTAAAAAGATAGTGTA
CAAACCAAATAATTTCCAAATCCAGTAGACGAGGAAGAGGAGCTTGGAGGGGAGTATCAA
GGCATTGATATTTCTTCGTTAAATCGAAGTTCTGGAGTTAGAAAATATTTTAAAGTACTC
TACCAGGGATATGTAGATGGAGGAGTTACAATGGCGGAGACGGCTCTGGAAAAAGAAAAT
GAAAAAGCGAGAGCTAAATTGCAATCTGATGATGAATATTAAAATTACAGCTCAGAATGA


>Contig18522.0.g12(protein)
MNTINLLLFDFALAMWVRNATPKMAGDMSSGGHSLQAQFMIFRRAYTFFMKTKVLPYLVL
PGPVEIDEAKIGRQRWHFRGEFPKKIKWAFGMFCRTTQIPVIYEIKCKVHAYLVSILKRH
LRAGTVMHSDHHSSYVVLRSAKSLLAKYGFYHYWVNHSNLYVHEKFSFVMTGNIERVWSQ
LRHMMMPLKFQRNSKRIEEYLCTYMLQQMIKNKQRESWTLKMLRDFYKHQYYIYIKLRNA
EEDRVPGLRSIEEANSRLEELGMFFRDYEAEYHAKSLHHLTLFKNEDLDDVVKPLTTQDI
DPSIQNLRYDPHKHIFMTHKSRDDIVMHLDPREDKILRLQYIKFYEEDNGVGWYKKPQNQ
EVKEQKEINPDIFSIQSGSNYRIQSNFVDLTNDQEAQDKNKQNNHSQKADNQISNQKDSV
QTKQFPNPVDEEEELGGEYQGIDISSLNRSSGVRKYFKVLYQGYVDGGVTMAETALEKEN
EKARAKLQSDDEYQNYSSE