Identifiers and Description

Gene Model Identifier

Contig237.1.g129

Standard Name

IRE1

Aliases

Contig237_1_g129

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR079C1.999618694399617e-70IRE1 SGDID:S000001121, Chr VII
I from 261591-258244, Gen...
T. thermophilaTTHERM_006410801.9997255150861791e-53Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig237.1.g129(coding)
ATGATCATGCTTAGTATCATATTAATTAATTTGTAATAAACTAGTACGGAGTCTACTTTT
AAACTACCATCAAAAGTAGGATCAACAGGCTTTGAGAAAACAAAACGTAACACAGACGAA
ATGCTTCTCGTCATAAGTGTTGATGGAACCTTATAAGCTCTAGACAAAACAAGTGGTGAA
TAAATATGGAAGACTCAGTTGGAAATGCCAATGATAGGCTCTTATGAATTCGATAACAAA
ATTCCTAGTGAAGATGCTTTTGTGCCACTAGTAGATGGAAGTTTAGTTAGATTTGATAAG
GAAGGGTTCTTAGAGAGAACTACTTATAACGTGAGAGATCAAGACTTACCAAATTTCTTT
AACAAGAATCAATGCTTGGTTACGGGCTAGACAAAAACGACAGCGATTTAAATTGATTTA
AGCAATGGAAAAATAATTCAGACTGTGGGAGCAGATTTAAGCACATTTTAAGGGTTTAAA
AAGAAACAACCTACAGAAACTAATGATAATAATTCCCAATCTGAAAGTAGGCACCAGTCA
CAGAGTTCTTCACCTTATGAGAAAGATCCATTCTGGCTAGTGATGAAAAACTATGATTAC
CTGTCCTATGATCACTAGAACGGGATGACTTAGTGGTCTATTTTTTACTCAGAATTCTCT
AATGATAAAACACGTATGAACTAATAAACCAATAAATAATCAACTGAGTTATCAAGTTCT
TTCTTCAATCCCTAAAGAGAGCAATCAATCTTTGCGAATGGAAATATTCTCTATTCAATC
ACCTTAAACAATTAAAATCAGCCTATATAAAATTGGATATATCAATCAGTCACCCCTGTC
TACCAAGTTCTAAACATTAACAGATAGACTGATGAAGTCAGTGAAGTACCATTTAACGAG
TTACTCGAAAGGGATATAAACAACATTAAATTGATAAATATTGAAAATTACTTATATGCA
GACCATTCTTATAAGTTCATACCCGCTTATAAGAAAAATGCACTAGATGGGGCTAGCGAA
GTACAGAGAAGGAGCAATGAACTATCTTTGTTAAATCCTAATTATTAAGAGTTAAAAGTT
CCAATCAAAAACCCAGATGTTTCAAATTTAGATGAAATCAGAATGATAGATGATCTCAGT
TAACAAACTAATAATATTGATGTAATTTTCTCTAATTATTCAAATGAAGAAAATTCAAAT
ACTAAAAATGAGACAAAGAGCATCTGGGATTTCTTTTTAAAAATAGAATTTATTGTGTTT
ATTGGAAGTCTATGCTTCATTGTATGGATTATGTTGAAATTGAAGCTAATAAAGATTGGT
TTCGATTCCCATACTTAATAATAAAGCACTTAAAATGAAATTAAAGTGTAAGAAGAAGTC
AAGCCAATTGAACCAATAATCAAAGAAGTAATAAAAGAGGTTTTAGTTGTTAAAGAGCCA
GAAAGAAAAATCTAAATTAATGATAAAGTGATTTTAGGTTTAGGAAGCGGAGGTACTGTG
GTATTTGAAGCTCACTAAGAAGTCTAATTTTTGCAAAAGGTCGATCTTCACCCAAATGTT
ATAACTTACTACGACAAAGAGGAAGATAAGGATTTCGTTTATTTAGCAATCGAGAAGTGT
GAAGGAAATTTAGAGAACTTGGTTGAGCTTATGAAAGCTGTTACTTTGACTGAAGAATCT
GAGTGGAAAAATCTACCTTTAGCTTAACTTTATCTTGCGTGTAAGAATGAACTTCATGAG
CCTGCATCCATGATCCAAATTATGCAACAATCATTGAGAGGTTTAAAGTTCTTGCATGAT
AATAACATTGTTCATAGAGACATCAAGCCACACAACTTGCTTTTAAATAAACTCAAATGC
GTTAAGTTATCAGATATGGGTCTCTCTAAATAATTATTTGAAGACTAGCTATCATATCAT
ACAGAAGTTAAAGGAAGTTTAGGCTGGCAAGCTCCAGAAGTCATTCACTCAGAGAAGGAA
CACAAACCCATGAAAACTACACTCTAAAAGACTTTCAAGGTTGATATATTTTCTATGGGT
TGTGTGTTCTATTATCTTTTATCCAAGGGCCATCATCCATTTGGCTAGAGATTTGAAAGA
GAGAAGAATATTTTGAATGGCAAGTTTAATATCAGTTAAATTTTAGAGTAGCTGACTTAT
GAGCGAAGCAGAGAAGCTGAAAATCTCATTGCTTTAATGATTCAATAAGACCCAAAGAAG
AGGCCAACTGCGACTTAACTTTTAGCACACATATTTTTCTGGAGTAATGACAAAAAACTT
AAGTTAATATAAGACTTGTCTGATAAACTTGAATTCAATAACTAGGCAAACAGTGACTTA
ATTTAGAAGCTTGAAACATTAGGGACGAAACATAATGTATTGAAATTATGTTTAAATAAC
TGGACAACTCTTCTACACCCTTCACTTATATAAGAACTTTAAAAATGGAGAAAGTACAAC
TATTAGTCACTAACTGATCTCTTAAGATTCATAAGAAATAAAAAGAACCACTTTAGAGAG
CTCCCAGAGGTAGCAAAATAATTCTTGGGTAATACAAACGACACCTATATGAGATATTTC
ACAAAATTATACCCTAATATGATGCTTGCAGTCGATGAATATGTCAGAAAGAATCTACTC
AATGATCCCTTATTTGCTCAGTATTACGATATCAATATTATAATCTGA


>Contig237.1.g129(protein)
MIMLSIILINLQQTSTESTFKLPSKVGSTGFEKTKRNTDEMLLVISVDGTLQALDKTSGE
QIWKTQLEMPMIGSYEFDNKIPSEDAFVPLVDGSLVRFDKEGFLERTTYNVRDQDLPNFF
NKNQCLVTGQTKTTAIQIDLSNGKIIQTVGADLSTFQGFKKKQPTETNDNNSQSESRHQS
QSSSPYEKDPFWLVMKNYDYLSYDHQNGMTQWSIFYSEFSNDKTRMNQQTNKQSTELSSS
FFNPQREQSIFANGNILYSITLNNQNQPIQNWIYQSVTPVYQVLNINRQTDEVSEVPFNE
LLERDINNIKLINIENYLYADHSYKFIPAYKKNALDGASEVQRRSNELSLLNPNYQELKV
PIKNPDVSNLDEIRMIDDLSQQTNNIDVIFSNYSNEENSNTKNETKSIWDFFLKIEFIVF
IGSLCFIVWIMLKLKLIKIGFDSHTQQQSTQNEIKVQEEVKPIEPIIKEVIKEVLVVKEP
ERKIQINDKVILGLGSGGTVVFEAHQEVQFLQKVDLHPNVITYYDKEEDKDFVYLAIEKC
EGNLENLVELMKAVTLTEESEWKNLPLAQLYLACKNELHEPASMIQIMQQSLRGLKFLHD
NNIVHRDIKPHNLLLNKLKCVKLSDMGLSKQLFEDQLSYHTEVKGSLGWQAPEVIHSEKE
HKPMKTTLQKTFKVDIFSMGCVFYYLLSKGHHPFGQRFEREKNILNGKFNISQILEQLTY
ERSREAENLIALMIQQDPKKRPTATQLLAHIFFWSNDKKLKLIQDLSDKLEFNNQANSDL
IQKLETLGTKHNVLKLCLNNWTTLLHPSLIQELQKWRKYNYQSLTDLLRFIRNKKNHFRE
LPEVAKQFLGNTNDTYMRYFTKLYPNMMLAVDEYVRKNLLNDPLFAQYYDINIII