Identifiers and Description

Gene Model Identifier

Contig12471.0.0.g107

Standard Name

IPO4

Aliases

Contig12471_0_0_g107

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005481408.998448382613942e-77hypothetical protein
SGDYER110C2.0003218023735366e-33KAP123 SGDID:S000000912, Chr V
from 382103-378762, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12471.0.0.g107(coding)
ATGGAAAGTCCACAAGTAAACTTCGATGCTATCACTACTGATGAGTTAGCTAACATTCTT
TCTCAACTATTCTTGCCAAACACAGAGCAGGTAAAGCAAGCCACTGCTCTTTTGAAGGAA
TATTTCAAGAAAATTTAAGCATTAGAAAATCTGCTTATCCTGATGTCTACAAACCCAAAT
CAGAACATTAGACAAGTCTCTTGCATTTATCTAAGGAAAATTATTGGTAATCTATGGATG
AACTTGCAAAAAGAGAATTAAGAGAAGACTAAATAACTTTTATTGCAGAGATTCGTAGAG
GAACCAGTTCCCCTCATCAAGAAAAACATCGCAGATGTCATTGGATCTCTTGGAAAAATC
TTGATTCCCAATAAAGAATGGAATGAACTGTTTTAATTCTTCTTCCAATACAGCAACTCA
GAAAACCTCGTTGATAAAGAATTAGCCATGATCCTGCTTTCAGTTATCATTGAGTACTTC
TCAGTTGATGAAATTAAGGCATACTATGATGCTCTTAACAAGATTATTGAAGGTCATTTG
CAATCAGGAGTGGTTTCATTGCAGACTCTAGCTATTGAAACTGTAAATAAAATTGCTTAG
ACTCCTAAAGCAATCAAAATTCTGAGAAAGTACAAGAATTTGATACCACTTGTTATGGGA
GCTCTTCAGTTAGATTAAGAAGACATGATTCAAAGAGTTTTTGAGACCTTGAATGAATTC
GTAGAAATAAAGAAGGTTCTAGCACCTCATTTACCTTTACTGATTGATGCAGCATTGAAA
ATATCAGCAAACACTACATTCTCATTAAACTTAAGAGAAATTACAATGCTTTTCCTAGAG
CAAATTGCTGACAATTATAGCAGATATTTGATTAAGAAGAATGGCTTACATGTTATTGAT
AAGATTATTGAGACAGGATTTACTATTGCTAGTGAAAGTGAGCAAGATTATGAAGGAGAA
GTAGACACACCACACACTTTGGCATTATATTTGATATTCAATTTTGCAAGTGAAGTTCCA
AATAGTGTTGTGTATCCAATTATCATGAAGTATGTAGAAAAGTTTGGAACATCATAAAAA
GAGTTGGAGAGAAAAGCAGCTATCAAGGTTCTAGGTTATATTTGCGATTCAACTTGCCTC
GATATGATCAAAGAAGATATAGACAAGATCACCTAGTTTATCGTATCTAAACTCCAAGAT
CAAAGTTTCGTTGTGAGAGAAGCAACTGCTGAAACTGTAGGAAAATTCTCAGAATATGTT
GTCCCCGATTTCTTAGACATGCATCAGGAGGTTGTTCCATCTCTATTGAAAGTTTTGTAA
GAGTTAACCATTCAAAATGATTTGACAATCTAAAAGAGTTTGTTCGCATTACATGAATTC
ACAAACAATCTTCAAGACGAAGTAAAGACATATTTACCAATTTTGATACCATTGTTGTTG
AGTTACATTTAGAACCATTAATACTCAAGAGACGTTAGATATTGGGCTCTCACAGCTATG
GGCTCTGTTGTAAGCTCTGCTTAAAATAAGATTCTTCCATATCTTGATTAAGTTTTGAAA
GCACTCTATGATACTATTATCAATGAACAATCAGGATCCTCAGAGTAATTGGTACGTGGA
CAGTCATTGATGTGCGCTGGTTAACTTGCTGGGGCAGTTGGAAAAGAAAAATTCCCATAA
GCATGCATTGAGACTTTCACTAAATATGCTCTACAATTTTTGACTGAGTAAAATAAATAT
GAGTTAAGAGAAACTGCTATATCATATTTTGCTGAGCTAGCAAGGCTATTGAAGGGAGAT
ATGGCACCAATTATTGATTAAGTTTTAACTGAAATCTTAAACTCATGTAAATCAAATGCT
GGAGTTAAAGAAGAACTTCAATAAAAACCTAAGGAAGCTTTCTCACTTGATTCAGACAGC
GAGGATGAAGCCGATCTTGTTGGTATGGATGTAGATGTAAACTTCATTGACGAAAAATCT
GCAGCAGTTCACGCTTTAGGTAACTTGGCTTTACATTGCTCTGCACTCCTATTACCAAGA
ATGTAAGAAATTTTAGACGTCCTAATGGAAATATCCTTCTATTTCCACGAAAACATCAGA
TATCATGTTTGCTAAACCTATCTATAAGTCGCAATTGGACTTCTTAGACACTTACTGAAC
ATCGATGGTAAATTTTAATGGAAAAAGGGTCTTCCAGTTTAAATCCCACTTCCAGATAAA
GTTCAAGAATTTATTGACACTATTATATTCCCTCATTATTACAAGATCTTCGAGGATGAA
GCTAACAAAGAAGTTATTGAGAAGACATTAGAATGCATTAGAGAAATGTGTGAGGAGCTT
GGACCTGGTTGTGTTGTAAATCAAATCGACAATCTTCACAACATGCTACTTTTATTGCTT
GATAAGTAAGCTTTCTGTTAAGGAAAACCCAAGGATTTCAAGGGCGAAGAAGAAGAGGAA
GATGGAGATGAGTTCTAAGATGATGAGGAGCAAGATGACGAAGAAGATGAAGACGAAGAT
GATGATATTGATCACGATGAAATTATTCTAGGAAATACAACTGATGTCATTATAGCTCTT
TCTAAGGCATTCGGAGACCAATACATGAACTATTTAGCTAAAATTGGACCAAGCTTGGTT
AAATATTTAGATGACACCCACCCAACTAGTGATAGAGTTATGGTTGTAGGATGTCTTGCT
GAAACTTTCAATAACTGCCCAGCTGCAATCCCAATTTACTTCAATGATTTCCTTCAAATT
ATCTTGAAAAACTCAACCACAGATCACAGCGGTCTCAACAGAAACTGCGCTTATGCTATC
GGTATTTTGGCCTAATTCTCTGGTGTACTTTTGGGACAAAATCTCCCACCAGTATTGGAA
GCTCTCACAAGATTACACGCAAACAGTGAGGAGTAAGATGCCAAGGATAATGTTGTTGCT
GCTACTTGCAGAGTTGCTCAAAACTATTCTCAACAAGTTCCATTTGACGAGATGCTTAAC
TTTATTCTATCAAAGATTCCATTCACTGGTGACCTCAATGAAAATGAAACTGCTCTCAAA
TTCGCTTTCAATCTTTTTTCACTAAGTAAGCTAAATATTATCATCCTAATTTAAATATAG
CCCCTGAGAAAGTACAGCCATACATGCAATAAATTACTATTACTTGCTTGA


>Contig12471.0.0.g107(protein)
MESPQVNFDAITTDELANILSQLFLPNTEQVKQATALLKEYFKKIQALENLLILMSTNPN
QNIRQVSCIYLRKIIGNLWMNLQKENQEKTKQLLLQRFVEEPVPLIKKNIADVIGSLGKI
LIPNKEWNELFQFFFQYSNSENLVDKELAMILLSVIIEYFSVDEIKAYYDALNKIIEGHL
QSGVVSLQTLAIETVNKIAQTPKAIKILRKYKNLIPLVMGALQLDQEDMIQRVFETLNEF
VEIKKVLAPHLPLLIDAALKISANTTFSLNLREITMLFLEQIADNYSRYLIKKNGLHVID
KIIETGFTIASESEQDYEGEVDTPHTLALYLIFNFASEVPNSVVYPIIMKYVEKFGTSQK
ELERKAAIKVLGYICDSTCLDMIKEDIDKITQFIVSKLQDQSFVVREATAETVGKFSEYV
VPDFLDMHQEVVPSLLKVLQELTIQNDLTIQKSLFALHEFTNNLQDEVKTYLPILIPLLL
SYIQNHQYSRDVRYWALTAMGSVVSSAQNKILPYLDQVLKALYDTIINEQSGSSEQLVRG
QSLMCAGQLAGAVGKEKFPQACIETFTKYALQFLTEQNKYELRETAISYFAELARLLKGD
MAPIIDQVLTEILNSCKSNAGVKEELQQKPKEAFSLDSDSEDEADLVGMDVDVNFIDEKS
AAVHALGNLALHCSALLLPRMQEILDVLMEISFYFHENIRYHVCQTYLQVAIGLLRHLLN
IDGKFQWKKGLPVQIPLPDKVQEFIDTIIFPHYYKIFEDEANKEVIEKTLECIREMCEEL
GPGCVVNQIDNLHNMLLLLLDKQAFCQGKPKDFKGEEEEEDGDEFQDDEEQDDEEDEDED
DDIDHDEIILGNTTDVIIALSKAFGDQYMNYLAKIGPSLVKYLDDTHPTSDRVMVVGCLA
ETFNNCPAAIPIYFNDFLQIILKNSTTDHSGLNRNCAYAIGILAQFSGVLLGQNLPPVLE
ALTRLHANSEEQDAKDNVVAATCRVAQNYSQQVPFDEMLNFILSKIPFTGDLNENETALK
FAFNLFSLSKLNIIILIQIQPLRKYSHTCNKLLLLA