Identifiers and Description

Gene Model Identifier

Contig18859.0.g5

Standard Name

INTS3

Aliases

Contig18859_0_g5

Description

Conserved protein (DUF2356)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007720000.000004000864880866421hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18859.0.g5(coding)
ATGCAAAATTATAAGCAAGGGAATGTAACTAAATCTTCAGGAGGTGGCACCAACTCAACT
GGTTCAAAGATTTAGGCAATTCAAAGTGCCACTAAGCACCACGCTTTGGCTTCAAGTTTG
TGCAACTACGAGAAATTCGATGTGCCTACTGAATTGGAAATTGAGATATGGAGGTCATGG
AAAGAATTTAAAATTTTGCTTAAAAATGTGACTTCTTAAAATGAGAGAGTCAATATATTG
CAGAGAGAGGTTTCTTAAAGTCATGAAAAAAATGATAAAATTATTAAAGCAATTGTCTAT
GGTATTTTGCATTAGCAAAGTTAAAAGGGAGTTATTGGAAGTACCGGCACTGGATTGATT
TAGAGTGCTGCTGGGACTCAAGCATCTTCTAAACAGTAAAACTCACCAGAGACGCTTCTA
GCTGAACTATCAAGCATAACTATGGACCACTACGAGTATGTGATAAACATTTTGCTCAGT
CTAATCAGAGAAAGCTACGATTACTTAAAACAAAATGCTGTGAACTAAATATTATGGCTT
TGCGACAATTTGATAAGCAAAGCTGTACCTAGACTCTTTGAAGTGTTTTTGGAGTTGATT
AGATGCGTGACCCCTATAACTACTGACAAGAAATCTGTGAACTTGAATGTATAGCTTGTG
GATATTTTCAACAGAAACATCAATTGGGTAATTCAACACCCTCAACAGACCCGCTTCTCA
AGTTTAATTTTCTTCAAATTCCTCAGATAAATAGAAGAGCATATTGATTTCGATGAACTA
AGAGCCTAAGAAATAGCTCTATGCTTGAGAATATGGGAAGTAAAGAAGGACGAATGCTAT
GATATTGGGAGGGAATTTATGCGAGTTTTCGTTAACATATTGAGAATCCCTTAGATGAAG
ATCATATTTGAGGATATTATATAAATTATCAACGAAAAGCCGCTATTTTATCATCTTTAA
GGCATGCAGAAACAATTCAGGGATGAGTACTTGAGATACCTTATTCCATTAAGTGTTGAA
GAAAAGCTTAATCACATGTTGATTAATATTCCCTTAGAAGCTTATTAGTGGTACTTGAAA
TGGTTTGTGGACTCTTTAAAAGTACAATATGGTTCAGATTCTGAAACTATCATGGTCGAC
ATAGTGAGACACATAGTTGTGAACGTAAAATAAGATTAAAATATTGTGAGACAGTATAAC
ATATTACCCAAATATGTATTAATTGCAGGCATCATAAATTCTCAGAAACATGAAATATTA
ATGAGTGCTACTATGTCTGCTGTGTTCATTGATTGGCTTCACTTCTCAGAGTCTTAAATG
CATCTCTATGAACCTGGCATGATGTTAATCTATAAATCAGTCGATAAGTATCCTTAGCTT
TCTGAGAGACTGATCGAGTACCTCTTTTCTTATGTGCACCTTTAAGATGAGACACGAGTT
TAAGAGTATAGTTTGAGCGTATAGAAAGTGCTAATAGCTTTCGAGAGACTTAAATTACTC
CCTGTTACAGTCCACAATTAAGCAATTAATGTAACTCAGCAATATGGAAGGATAGCTGAT
TTAATCAATAACCCACGACTCTCAGCTGGCATTCAAAATAAGTTGAAGAAACTTTACACA
GCAGATTAAATAATAGCTTCTTAATAAAGATCAGTACAAAGATAACTATTTGCCAATTCT
TCAATCAATAACCCTTATTCAACTTAACAAAGATCTTCAACCAATGCAGACATGGAATCG
GACTATATTCAATATTAACAATTCCCAGGTTCAGGGTAAAACTCTGGAATAAATGAAGAC
TATAATTAGAGCATGTTTAGTCCACCTCATGAACCAGTCACTAGCGATACTAATAACTTA
GAAGATAAGCTTTCTACAAACGATTTGGTTGGTGATTAAAGCAATAACTCTCTGGCAGTA
ATTTCAAGTCCATAGTATGAATTGGAAGTGGATGATGACAATTAGATCAACTCAGCGATG
GATTTTAATCGAGACAGTAATAGCTTCTTAAGTGGGCAAGGTGACTAAAATTCCACATTT
GATGAGTTAAACCTAAATTAAAGTGAAAATAATTAAATGGCTTAGAAAGTGGATGAGGTT
ATGTACAATCCAGATCATGACTATTTCGATTAAAGTGAGGACTCAAACAAGCCAATTGAT
GTAGTTATGAAAACCTAAGCTGTTTCTAGTTTATAACCAACTCCTGTGAAGTAAAAGAAG
AAATTAACAAAAAAGGTTTCGCACACTAGTTCTGATTCTGATTCTTCATCAAACTCATCG
TCCTCATCTTCCTCGTCTAAAAATAGCAAATCTAAGAGTTTAGGGGAAGATTAGAGTATG
AGCGGAGCAGAGAGTAGCAGCAGTAGTAGCTATGATTCCCATAGCGAAGATGAAGAAATT
AAAGCTGCAAAAATATTAAAATCAAAGAAGATTGAAAAAAATCCTCAAAACAAGTAGAAA
ATTGATATTAAAGTGCCTGATCATATAGTTAAGAAATACTTAGAAGCACAGATTCTTGAG
AAATTTATCAAACATTCAAATAAAGCTAATCTTAAAAAACTACTTGATAATTTCTGTGAA
AATGTAATCAAGATTGATAAGTAAAAACAGTCATTAAGCAGCAGCAGTACCCAGAGTAAC
CTTTAAAATCCAGCTAGCCATATCAGAAATGAGTTCTCCGAGATTGCATTTATAATCTAT
GAAAGTCTTAGAGAAAGTTTATCCCAATAATCAATAACTGCTTAACTGAAAAAATGGGAT
GACTATACTTTTGTTACGCTTTTTATTTACTTGATTGGCATGAATAAACCTTCAACTACT
CCTTAACTGATAATTATTTCTTAAATAATTCGTGCAATGACATAATTTGACGAATTCTTT
GAAGTGAGACTCCTAATTCACTTATTCCTATTTTAAAACAGGGAATTCAAAATGATAGAG
CATTCTATTATGATTCAGGTTCAAAGTTTGTTTAAGAGCTAACCTGCTTTGTCACAAATA
GCTTAACAAAATTTCTGGAATATGATAAATTCTCATAAGATTTTAGAATTCAGAACTGAT
GAAAATCTTTTGAAATGTGTGATATATGTAGTCAAATCTAATTTTAATCGCTTGAGACTT
GAAAATGATACAGCTAAGCTATATGCTTCTACTTTAAATGGCTTCAAATAGTTCCTCAGG
CTATACTTTTTAGAATCCAATAACTAATAATAAGAGAAAGACTATATTATAGAATTCAAA
GCATTGCTTGATTTTTACAATGAGTTCTTAGACAGTCAGTAGCTCTTGCCTGAATTACAC
TACGCATTAGATATTTCCATAGACTCCATAAAATCTGATTCAGCTTTGAATTTGACAATT
TAAAAATTATTTGAGGAGTTTAAAGGTGCTCCAAGACTTCACGAGATTATAAGTCCAGTA
AAAGGCTTAACAGCTTACATAGGGAGATGTAGTTAAGGTTAGAAGAAAAATGGATTATAA
TAACAGAAAAAGGAAAGTGAGAGGTTTGTTACAATAGTGAAATCTGATAGCAATTACGAA
TGGGTCACACAGTAATTTAATAAATCATGA


>Contig18859.0.g5(protein)
MQNYKQGNVTKSSGGGTNSTGSKIQAIQSATKHHALASSLCNYEKFDVPTELEIEIWRSW
KEFKILLKNVTSQNERVNILQREVSQSHEKNDKIIKAIVYGILHQQSQKGVIGSTGTGLI
QSAAGTQASSKQQNSPETLLAELSSITMDHYEYVINILLSLIRESYDYLKQNAVNQILWL
CDNLISKAVPRLFEVFLELIRCVTPITTDKKSVNLNVQLVDIFNRNINWVIQHPQQTRFS
SLIFFKFLRQIEEHIDFDELRAQEIALCLRIWEVKKDECYDIGREFMRVFVNILRIPQMK
IIFEDIIQIINEKPLFYHLQGMQKQFRDEYLRYLIPLSVEEKLNHMLINIPLEAYQWYLK
WFVDSLKVQYGSDSETIMVDIVRHIVVNVKQDQNIVRQYNILPKYVLIAGIINSQKHEIL
MSATMSAVFIDWLHFSESQMHLYEPGMMLIYKSVDKYPQLSERLIEYLFSYVHLQDETRV
QEYSLSVQKVLIAFERLKLLPVTVHNQAINVTQQYGRIADLINNPRLSAGIQNKLKKLYT
ADQIIASQQRSVQRQLFANSSINNPYSTQQRSSTNADMESDYIQYQQFPGSGQNSGINED
YNQSMFSPPHEPVTSDTNNLEDKLSTNDLVGDQSNNSLAVISSPQYELEVDDDNQINSAM
DFNRDSNSFLSGQGDQNSTFDELNLNQSENNQMAQKVDEVMYNPDHDYFDQSEDSNKPID
VVMKTQAVSSLQPTPVKQKKKLTKKVSHTSSDSDSSSNSSSSSSSSKNSKSKSLGEDQSM
SGAESSSSSSYDSHSEDEEIKAAKILKSKKIEKNPQNKQKIDIKVPDHIVKKYLEAQILE
KFIKHSNKANLKKLLDNFCENVIKIDKQKQSLSSSSTQSNLQNPASHIRNEFSEIAFIIY
ESLRESLSQQSITAQLKKWDDYTFVTLFIYLIGMNKPSTTPQLIIISQIIRAMTQFDEFF
EVRLLIHLFLFQNREFKMIEHSIMIQVQSLFKSQPALSQIAQQNFWNMINSHKILEFRTD
ENLLKCVIYVVKSNFNRLRLENDTAKLYASTLNGFKQFLRLYFLESNNQQQEKDYIIEFK
ALLDFYNEFLDSQQLLPELHYALDISIDSIKSDSALNLTIQKLFEEFKGAPRLHEIISPV
KGLTAYIGRCSQGQKKNGLQQQKKESERFVTIVKSDSNYEWVTQQFNKS