Identifiers and Description

Gene Model Identifier

Contig11682.0.g116

Standard Name

INO80C

Aliases

Contig11682_0_g116

Description

YL1 nuclear protein C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08265 ) YL1 nuclear protein C-terminal domain
  • ( pfam09127 ) Leukotriene A4 hydrolase, C-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005262200.0000000000002999981760818895hypothetical protein
SGDYEL044W0.000000000800327577657144IES6 SGDID:S000000770, Chr V f
rom 69757-70257, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11682.0.g116(coding)
ATGCATGTATAATGCCCTTTTAATGTTCGAAATAACCAGCATCTTGTTGGATTGAACCTT
ATAAATTCACTTTAAAATAAAGAGCAACACTATGAGGAATACTTGAGAATGGTGAAAATG
AATTTAACAAGCGATTAGATATCAAGATTGGACTATGTCTACCCCATTGAGTTTATGGGG
GATTAAGATAGAATGCTTTAATGGAATAAAATAGCAATGAGGTCAAGTGAATACGCTTAT
GGATAGAAACTGGACTTGTTCCTATTCGACACTATTATTTTGAATTGCTAAAATTTGAGA
AAACTTATCAGAGATGCACAATTCCTTGTTAATGAATTAGACAATCAGTATTCAGACTTA
TTTATTGTAATGAAAAACGATTAAGACTTTCCAAGAGATGCATTGAAATATATAAACAAA
ATCTTTTCAAGAAATGAAATTGACCTGAGTCTAAAAAGAATTTTTGATATTGCCATTTAT
GTAGATATAAAGCCCGATTAATTAAGGAAATTCTTGTATAATTTCGCTTATGATCATGAA
ATGTTCAAGAAGTAATTAGAAATGATGCAAAGCCCTGTTTACGATATATTTTGCTAAGAT
TTAGCGAGTTCAGGTATTGGAAGAGGAGCTAATCCTAATGGGCCCTCAATATTGGGAAAA
CGTAGAGGAGGTCCAGACGAAGAATTAATTAATCAAAGCTCTATGATGAGTTCCGCTAAT
TTAGGTGGAGTTAGTTTGGGCGATGATGACTTCAATTTGAGGCCAGGCAATATTCCAACA
GAAAGACAGACAAAAAGAGTTTATGAGAACCAGAATAGTTTTGCAAACTTCATGATAAAG
AAAGGAGATATGATAAATTAGCTCCTTGAAGAAAAATCAGCATTTGCTTATAAAAGTGAA
GAGTGGCTAGAAAAGAAGGAAAAATAAAAGAGATTTTAGTCGAAACATACAAAGAATCTA
AAATAGATATGCGGTAATGATCCTTATGGAGAGTAGCTGGGATCTTACTAATCTATTGAT
GGGGGAATTAGTGTCAAGAAACCAAATAAATACTGTGATTTCACAGGTTTTCACACTAAT
TATTAAGATCCAAAGACTGCTCTGAGATACTACAACAATGATTTTTACCCAGTGGTAAAG
AATATACCTGAAGGTGTTAAAAATGAATATTTAGCTATTAGAAAGGCAAATGTAATTTTG
AGATGA


>Contig11682.0.g116(protein)
MHVQCPFNVRNNQHLVGLNLINSLQNKEQHYEEYLRMVKMNLTSDQISRLDYVYPIEFMG
DQDRMLQWNKIAMRSSEYAYGQKLDLFLFDTIILNCQNLRKLIRDAQFLVNELDNQYSDL
FIVMKNDQDFPRDALKYINKIFSRNEIDLSLKRIFDIAIYVDIKPDQLRKFLYNFAYDHE
MFKKQLEMMQSPVYDIFCQDLASSGIGRGANPNGPSILGKRRGGPDEELINQSSMMSSAN
LGGVSLGDDDFNLRPGNIPTERQTKRVYENQNSFANFMIKKGDMINQLLEEKSAFAYKSE
EWLEKKEKQKRFQSKHTKNLKQICGNDPYGEQLGSYQSIDGGISVKKPNKYCDFTGFHTN
YQDPKTALRYYNNDFYPVVKNIPEGVKNEYLAIRKANVILR