Identifiers and Description

Gene Model Identifier

Contig15001.0.g24

Standard Name

ING5

Aliases

Contig15001_0_g24

Description

Inhibitor of growth proteins N-terminal histone-binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam12998 ) Inhibitor of growth proteins N-terminal histone-binding
  • ( pfam00628 ) PHD-finger
  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam01412 ) Putative GTPase activating protein for Arf

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR064C3.0002687256732656e-20YNG1 SGDID:S000005590, Chr XV
from 446738-446079, Genom...
T. thermophilaTTHERM_000463905.000468829272308e-18PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15001.0.g24(coding)
ATGTCAAAATTTGAGGAATTTTTGCAAGAACTCAGCTATCTCCCTACTGAGATTAAACGG
TCACTAGTGCTCATGCGTCAACTAGATGTTAAAAAGGATGAATTACAGAATCTAAACAAT
CGACTCGCCAAAGGCTACTTCCAATCCCTTCAAAAAAAGAAGACAGAGAAGGAGAGTCAG
CAAGATCAAAAGAAAGTGATAGATTAGATTCGCCAGAACTACGATCACATAGAGCGGCTT
TCCCAGGAAAAATTGGATTTGGCAAAAAAGGCATTCGCTTATGTTGAAGCTAATTTGGGT
AAAGTAAGCACAAGGATGGTCTAAATGGAAGAAAACATCATGAAGGAACAAAATGAAGGG
ATGGGAGGTAGCATGATAAGTTCTTATAAAGACTAAAACTAATCCAAAAAGACGAACTAC
GAGAGATCATCATCCAACATCATGAACATTGGCTAAGGGTTTGTTCAAAATGGAAGAATT
GATCCAAAGTCTAAGTCTATCAAGAAGCAGCAATATGGTAAAAATAAGCACCCAGGAAGT
TCAGGGAAGCTAGGTTACTAATTTTCAGAAAGTTCTGATGATTTAGACAATCCTTTAGAA
GAGACAAAGCAGTAGTAACAGTCATCACCTTCATTTGGATTGAATAAATACACTTTCGGG
GATGATGGTCTCGTTCACAATAATTATAGTAGTAGAAAACCAATACAGTCCGCCAAAAAG
TCTACAGTTAAAAAGGGAGGGAATAATAAAGGAAACATAGAAATGGAAGATGACGATGAA
ATTGAGCCTGTTACATATGAGCAGAATTAGGAATTACTGAGGGCTTTTGGAGGTCAAATT
ATGAGCACTACTCTTCAAAATCAATAATTAGGAATGGGAAATATGGGAGGGAACTTAAAT
CCACATAATACTCATGCTCATAATTAACTTCATGCTTAGTCGTTGATGCGCGAACCTACT
TACTGCTTCTGTAATAATGTTTCGTATGGTGACATGATTGCATGTGACAACAAAAACTGT
CCATACGAGTGGTTTCATTTTCCATGTGTAGGTTTAACTCAAAAACCAGAGGGCAAGTGG
TTTTGTTTGAAATGCCAGTAAACTTTGCAAAACATCAAAAGAAAACATATCATTGGAGCT
AACCATAACCAATCAAGTAACACTCCCCCTCCTATTAGCAGTCCACTATAGCTATTCTAA
TCTTCAGAGAATTAAAATTCTGATAATTTTAATAGTGATTAAGTGCAAATAGACACTTCA
ACTCATAAAATTAGCACTACAAAAGCGAACTAAAAACCATATAAACCCTAGTATTCAAAG
AAATCATTGTAAGTGAAGAAAAATATAGCTAAATCGAGGTAAAGCACCAGATTAGTCACT
AAACCCATTAGGTACCAGCAGGTTGATACTATTCAATAAAAAAGCGCGAAAGGCAGTCCA
GCAGGTGGAATAAAAAAGTTGAAATAAGCAGCTATAATTAAACCTAAGTCAGTTTTGAAA
AGCAGTCACAGTAAATTAATCGTTAAACCTTTAAACATAAAAAATGGTAAACAGTCCACC
AGAAAGTGA


>Contig15001.0.g24(protein)
MSKFEEFLQELSYLPTEIKRSLVLMRQLDVKKDELQNLNNRLAKGYFQSLQKKKTEKESQ
QDQKKVIDQIRQNYDHIERLSQEKLDLAKKAFAYVEANLGKVSTRMVQMEENIMKEQNEG
MGGSMISSYKDQNQSKKTNYERSSSNIMNIGQGFVQNGRIDPKSKSIKKQQYGKNKHPGS
SGKLGYQFSESSDDLDNPLEETKQQQQSSPSFGLNKYTFGDDGLVHNNYSSRKPIQSAKK
STVKKGGNNKGNIEMEDDDEIEPVTYEQNQELLRAFGGQIMSTTLQNQQLGMGNMGGNLN
PHNTHAHNQLHAQSLMREPTYCFCNNVSYGDMIACDNKNCPYEWFHFPCVGLTQKPEGKW
FCLKCQQTLQNIKRKHIIGANHNQSSNTPPPISSPLQLFQSSENQNSDNFNSDQVQIDTS
THKISTTKANQKPYKPQYSKKSLQVKKNIAKSRQSTRLVTKPIRYQQVDTIQQKSAKGSP
AGGIKKLKQAAIIKPKSVLKSSHSKLIVKPLNIKNGKQSTRK