Identifiers and Description

Gene Model Identifier

Contig12879.0.g6

Standard Name

IMPB1

Aliases

Contig12879_0_g6

Description

impB/mucB/samB family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12879.0.g6(coding)
ATGACATAAAATTAAACACGTTCTAAGCACTTATCTTTCCTGTTACTGCTTACATTAACA
ATCCTAGTCAATTAATCAAATCAAAAATAGTAATATTCTAAGAAAGTACATGTAGAGAAC
CCAGTCACCCTATCAGCCGGAGAAGCCTTTATAAAAGTAGGGAACGAGTTGACTTTTCAC
TTGTGGGATGGATTTTTGAAAGGGATTTATGAGAAGGATAGCATGCCAAGAAATCAATGT
TTCGGTTAAAAATCAATCGAGCACCTCTATACTATGATTCCCGTGTTTATGTCCTACAGC
AAAGATGAGTTCTATTTGAATCTAAGCAATTTTGTGAGAAATATTGTCGAACTTGTTCAA
GAAATTAAGAGTCATTGTCATTTATCCACTTTGATTAGAGACTTCAGGGAATACTGTGAG
TCAGACGAAAGCAACTGCAGCAGTAAAATGGCAATGTCCCGTTTATTGATGTATTTCTCA
TAGTTAAGTAACTTAATGAACGATATCTTAACTATCCCATCTCAATTCGGGTTATATTCC
TTTTATCTTGACGAGTATGCTATCATTAGAGAAATGGGGAATAAGTTTGGAGAAATTTTG
AGAACAATTACAGGTTTTGAACTTTAATGA


>Contig12879.0.g6(protein)
MTQNQTRSKHLSFLLLLTLTILVNQSNQKQQYSKKVHVENPVTLSAGEAFIKVGNELTFH
LWDGFLKGIYEKDSMPRNQCFGQKSIEHLYTMIPVFMSYSKDEFYLNLSNFVRNIVELVQ
EIKSHCHLSTLIRDFREYCESDESNCSSKMAMSRLLMYFSQLSNLMNDILTIPSQFGLYS
FYLDEYAIIREMGNKFGEILRTITGFELQ