Identifiers and Description

Gene Model Identifier

Contig22471.0.g96

Standard Name

IMP4

Aliases

Contig22471_0_g96

Description

Brix domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001521401.0000409741368237e-118Brix domain containing protein
SGDYNL075W2.9991172563576427e-86IMP4 SGDID:S000005019, Chr XIV
from 485607-486479, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22471.0.g96(coding)
ATGATCAGGAGAAATATTAGACTCAGAAAAGAGTATTTATTCAACAAAAACAAAGAGTTG
AAGGACAAGGATCACCAAGACAAGCTCATGAAAATTAAAAAAGCAGTAGAAAGTGATAAA
CGTCTGCCAACTGAATTCAAGAAAAATAAGGATGAATTATTGAAAGATTTGGAGCTTGCA
GATGATAAGACTATTGTGGCTAGATCTCACATTGATGATGAATACGAAGAGGCTAAATAC
AGAGACCCAAAAGTCTTGGTTACTACCTCCAGAAGTGCAAGTTAAAGGTTGATGCAGTTT
TAAAAAGAAATGAAGTTAATTATACCTAATTCAGTCAGAATTAACAGAGGTAACTACGTG
CTTAAGGATCTAGTGAAGATTTGCCAGGTCAATAACATCACTGATTTGATTATATTGCAT
GAGACTAGAGGAGAGCCAGACGGCATGATAGTATCACACATGCCCTATGGCCCCACAGCA
TACTTTGGAATGTCAAATGTAGTACTAAGACACGATTTGAAGGATAAAGTTGATCCAGTG
AGTGAAGCTTACCCTCACTTAATCCTCTAAAATTTTAACACAAAGTTAGGTGACAGAATT
TCAGACATCTTAAAGTACATTTTCCCCTTGCCAAAAGTAGACAGCAAGAGAGTCATGACA
TTCGTTAATGAAGATGATTTTATTAGCTTTAGACATCACGTTTACAAAAAGGAAGATCAT
AAAAACGTAGCACTCAAGGAGTTAGGACCTAGGTTCGAAATGAAGCCATATTAGATCGTA
TTAGGAACTGTTGACTTATAAGATGCCCAAAAAGAGTGGGTGTTGAGACCATATATGAAT
ACAGCTAAGAAGAGAGCATATTTATGA


>Contig22471.0.g96(protein)
MIRRNIRLRKEYLFNKNKELKDKDHQDKLMKIKKAVESDKRLPTEFKKNKDELLKDLELA
DDKTIVARSHIDDEYEEAKYRDPKVLVTTSRSASQRLMQFQKEMKLIIPNSVRINRGNYV
LKDLVKICQVNNITDLIILHETRGEPDGMIVSHMPYGPTAYFGMSNVVLRHDLKDKVDPV
SEAYPHLILQNFNTKLGDRISDILKYIFPLPKVDSKRVMTFVNEDDFISFRHHVYKKEDH
KNVALKELGPRFEMKPYQIVLGTVDLQDAQKEWVLRPYMNTAKKRAYL