Identifiers and Description

Gene Model Identifier

Contig22489.0.g1

Standard Name

IMP3

Aliases

Contig22489_0_g1

Description

S4 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR148W5.001742359316081e-68IMP3 SGDID:S000001191, Chr VII
I from 393534-394085, Gen...
T. thermophilaTTHERM_004340700.00000005001214305021125ribosomal protein S4 containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22489.0.g1(coding)
ATGAGAGAATTAAAGTTTCACGAGCAAAAGCTCTTAAAGAAGGTTGACTTCTTAAATTGG
AAGAAAGATGCTAACTTAAGGGAGATTGCTGTCCTCAGGAGATATCATGTTTAAAATAGA
GAAGATTATGCTAAGTATAATAAAATTGTTGGTCAAGCAACCAAATTAGTAGCAAAACTG
AAGACCTTGAAATCAAGCGATTTATTCAGAATTGGGTAGACCGAAGCCCTAGTAAACAAA
CTCTATGAAATGGGAGTAATTAAGCAGAGACAGGGTTTGAAGGACTGTGAAAGAGTTAAT
GTTGCTGCTTTTTGCAGAAGAAGACTGCCAGTTGTGATGCAGAGACTTAAAATGGCAGAA
ACTATTAAAGAAGCTGTCATGTACATAGAGCAAGGGCACGTGAAGGTAGGCGTAGAGACA
GTGACAGACCCAGCATTCCACGTGAACAGAAATTTCGAGGACCACATCACCTGGGTAAAG
ACTTCAAACATCAGAAAGAAGGTGCTCAAATACAACGATGACTATGACGATTTCGAGCTT
GTGGAATGA


>Contig22489.0.g1(protein)
MRELKFHEQKLLKKVDFLNWKKDANLREIAVLRRYHVQNREDYAKYNKIVGQATKLVAKL
KTLKSSDLFRIGQTEALVNKLYEMGVIKQRQGLKDCERVNVAAFCRRRLPVVMQRLKMAE
TIKEAVMYIEQGHVKVGVETVTDPAFHVNRNFEDHITWVKTSNIRKKVLKYNDDYDDFEL
VE