Identifiers and Description

Gene Model Identifier

Contig12701.0.0.g16

Standard Name

IME4a

Aliases

Contig12701_0_0_g16

Description

MT-A70

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007040401.9998944264638884e-101MT-A70 family protein
SGDYGL192W2.998577119979921e-31IME4 SGDID:S000003160, Chr VII
from 142246-144048, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12701.0.0.g16(coding)
ATGCATCTGCCAATGCAAATCATCACTCAGAACATGTTCAGACAAGGTAATCAGCACAGT
TGTCTCAACAGAACAGAGATTCTCAGAACACCAAGGTTAACCAGATCAACTAAAACGGAG
CTACAGGAGTAAACTCACTTCTCTAAACTCCCAAGAAGAAACTACTTGAAACTCCAAATA
GACATGAGAGAGATCTAGTCACTCGTTGACAAGAAAGTGAAAGAGTCTGCAGCAGCACAA
CAACAACTCTCACAGTCAGGTATCGAGGATTCTGCAATCAAGAGAAGCTTGAGACCCAGA
AAAGTTGAGAACTACAAGAACATGCTGGAAGGAGATGAGATTACTTTGAAGACTATTCAA
GATGAGCAAATCGAGGTTAAACGCAAGAAGAGAGAAGCTTCATCACAGAATCGCCTTGAA
GACGAAGATGAGGACGAGGACATGCTGGAAGTAGGTCAACAGATCGAGAGAGCAAGTGAC
GATGAAGACGATGATGACTTTCCCATCTCTACAAGAAGAAGTGCTCGCAAGAGAACAAGA
CGCCAAGATGTCGATGAAGATGAAGAAGCTATTGAAGTTAATCAAGTGGAGAGTTCTGAT
GCAGAAGTTGAAATACCTGCAAATGACATTGATACAGAGTCCTACACTGAGGGCACTAAC
AAGAGAAAACAGAAACTTAAAGCCAAGAAATAGGTTTTAGATAAAAAGAAGAACAAGACT
GAAGGAGATATTGATAAGGAAGATGCCGTTGAGGAAGAGGAAACTGTTTTTATTGATAAT
CTTCCAAATGATGAGTTTGAGATCAGACGTATGCTGAAAGAAGTCAAGAAGCACATAAAG
AGTCTTGAGAAGCAGTTTTTTGAAGAGGAAGATTCTGAAAAAGAAGAAGAGTTAAAGCAG
ATTAACAACAATTCTAAGCATGAGGAAGCTCTGTAAGCATTCAAAGAGACAAGTCACTTG
AAGCAGTTTTGGTGTATTCCACTCTCTGTTAATGTGACAACTCTCGACTTTGATCTACTT
GCAAAATCTTAAATGAAGCAAGGTGGCAGACTCTTCGATGTCATCACCATTGACCCCCCA
TGGCAACTATCATCTGCTAACCCAACAAGAGGAGTCGCTATCGCCTATGATACTCTAAAT
GATAAGGAAATTCTTAACATGCCTTTTGAGAAAGTATAGACTGATGGATTCCTGTTTATC
TGGGTGATCAATGCCAAGTACAGGTTTGCTCTTGAAATGATGGAGAAGTTTGGCTATAAA
CTTGTTGATGAGATCGCTTGGGTAAAGCAAACTGTGAATGGAAAGATTGCCAAGGGTCAC
GGCTATTACTTGCAGCATGCCAAGGAAACTTGCCTTGTTGGAGTGAAAGGAAACGTGAAG
GGTAAGGCTCGCTACAATATTGAGAGTGATGTAATCTTCAGTCAGCGTAGAGGTCAATCC
CAGAAGCCAGAAGAGATCTATGAAATCGCTGAAGCTCTTGTCCCAAACGGTTACTACCTG
GAAATCTTTGGAAGAAGAAACAACCTGCACAACGGTTGGGTCACTATTGGAAATGAGTTA
TGA


>Contig12701.0.0.g16(protein)
MHLPMQIITQNMFRQGNQHSCLNRTEILRTPRLTRSTKTELQEQTHFSKLPRRNYLKLQI
DMREIQSLVDKKVKESAAAQQQLSQSGIEDSAIKRSLRPRKVENYKNMLEGDEITLKTIQ
DEQIEVKRKKREASSQNRLEDEDEDEDMLEVGQQIERASDDEDDDDFPISTRRSARKRTR
RQDVDEDEEAIEVNQVESSDAEVEIPANDIDTESYTEGTNKRKQKLKAKKQVLDKKKNKT
EGDIDKEDAVEEEETVFIDNLPNDEFEIRRMLKEVKKHIKSLEKQFFEEEDSEKEEELKQ
INNNSKHEEALQAFKETSHLKQFWCIPLSVNVTTLDFDLLAKSQMKQGGRLFDVITIDPP
WQLSSANPTRGVAIAYDTLNDKEILNMPFEKVQTDGFLFIWVINAKYRFALEMMEKFGYK
LVDEIAWVKQTVNGKIAKGHGYYLQHAKETCLVGVKGNVKGKARYNIESDVIFSQRRGQS
QKPEEIYEIAEALVPNGYYLEIFGRRNNLHNGWVTIGNEL