Identifiers and Description

Gene Model Identifier

Contig11775.0.g82

Standard Name

IMA1b

Aliases

Contig11775_0_g82

Description

Armadillo/beta-catenin-like repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL189W0.0000000000009003435339752751SRP1 SGDID:S000005133, Chr XIV
from 284260-285888, Geno...
T. thermophilaTTHERM_010162200.0000000006999585478469937Armadillo/beta-catenin-like re
peat family pro...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11775.0.g82(coding)
ATGCATGAAGAGACAAGTTCAGGATCATCTTCACCTAAAGATTCTGCTGAAAACTCACTT
AAAGGAAATTTGAACTTTACTCTGGGAAAGAATAAACTCTCAAAAAAAAGGAAAACAGAG
AACTAAAGTATGAGAGGTTTACTGTAGAAGAGATCAAGGCCAGATTTTCTTGCTAAATCT
GAAGAATTTCATGGTAAACTCATTAAGAGGATCAGAAATGAGCAGATTTAGAGCAAGAGG
CAATACCAAATGAACTAACAAACATCTTTGACTCTTTCAGACTCTTAATCTCAAGTAATT
GTCTCTTTGAGTTAGCAAAATCCAAAATTCTGTGAAGTTCTCCAATTGAAGCGTAATATT
TTTAACTTTTAGAAGCTCATTCAAAGTAATTTGCCCCAAGGTATATTAAAAGGAGTAACT
TCCTTAAGGCTACTCTTGTTAGAAAAACTCGCAAGTGATAATTTCTACTGTTAATTGATG
ACAGATTTGATATTAGATTCAGGCGTTTTCAGGAATCTACTTGATCTATGCTATGAGAGT
TTTGATCAGTGTTTGGCTGAAGGACAGGAAATCAAAATTGAGGTTGCTTGGATATTTACA
AATCTAACAACCTCACCACCTGAACAGATAAATTTACTGTTTAATCAAGGATTATTTGAG
TCACTTCAATGCTTACTCTAGCATCCAGATTCCACTCCTGAAGTTAGAACTCAAGCAATT
TGGGCGCTTGGAAATTTGATATGTGACAGATAAAAGTTCAAGAACGCAATTCTTCAACTC
AACATAGTGGATGATGTGACAGAGTTTATGATTGCTTAACTTCATCAACCAAAGATGATC
TAAGAATGTTTGTTTTTCCTCGTTAACTTGATATAAAATCAGTAAAGAGTTTCAATGATT
GGTCTTGAATCTGCTGTGAATAGCATTTTTATTGTACTCAAAAGACTTGACTTCACTAAA
GTGTTGAACGACTCTCAAAACTCTGAAACACTTTTTACAATCCTTCAATATGCTCTATCA
TCAATACTCATTTTGATTAAGAAATTTCATGGGAATATTAGTCAATTCTTTGATTAGTAT
GAGCTTCATCAGTAAATTGTGTTGCTTATAGGATGCAATAACTTTCATGTGGCAGATACA
GCTTCTCACATTATTGGACTTTTATGCTATTTCTATGAAGAACAAGCTTGCAAGTTTCTC
AAATGCTATATTTTAGATGTCATTCATTCAAGACTTAGTGACACTAAGATACTTGAAAAG
GATTACTCAAATGAGATAAGGATTAGAAATAGACTTCTATGGTGTATTCATAATTTGAAG
TAAGAAAGAATAGATGTTCTGCAACTTATTGTCGAAAGATAAATGTTAGAATTAATGTAT
GATATTATGCTGTTTGGTGAGCTACCTAACTCAAACGAAGCTATTTTTATAGTCAACTTT
ATGCTACATGATAAAAAATACCCCTTAGTGCAATCTTTCTTGAGAAATGGTTTACTCAAC
GTTTTAATCGAATGTTTGAAAAGAAAGGATGATAGTGGCGTATTTTTACATGCAGTGATG
TTTTTACTATCAAGTTCTTTTAAAAAAGCGAGGAAATTTTATAAGTCTAAGATGTTAAAT
GAATTGTCATTTGGTTTTGAAATTATGGGAGGGATTGATCTAGTTGAGAATTTGCTTTTG
CATCAGAATAAAAGACTTTACAAGTTGACTTTGAAATTCATAGAGAGAAACTTTGATATT
GAGAATATGATATGA


>Contig11775.0.g82(protein)
MHEETSSGSSSPKDSAENSLKGNLNFTLGKNKLSKKRKTENQSMRGLLQKRSRPDFLAKS
EEFHGKLIKRIRNEQIQSKRQYQMNQQTSLTLSDSQSQVIVSLSQQNPKFCEVLQLKRNI
FNFQKLIQSNLPQGILKGVTSLRLLLLEKLASDNFYCQLMTDLILDSGVFRNLLDLCYES
FDQCLAEGQEIKIEVAWIFTNLTTSPPEQINLLFNQGLFESLQCLLQHPDSTPEVRTQAI
WALGNLICDRQKFKNAILQLNIVDDVTEFMIAQLHQPKMIQECLFFLVNLIQNQQRVSMI
GLESAVNSIFIVLKRLDFTKVLNDSQNSETLFTILQYALSSILILIKKFHGNISQFFDQY
ELHQQIVLLIGCNNFHVADTASHIIGLLCYFYEEQACKFLKCYILDVIHSRLSDTKILEK
DYSNEIRIRNRLLWCIHNLKQERIDVLQLIVERQMLELMYDIMLFGELPNSNEAIFIVNF
MLHDKKYPLVQSFLRNGLLNVLIECLKRKDDSGVFLHAVMFLLSSSFKKARKFYKSKMLN
ELSFGFEIMGGIDLVENLLLHQNKRLYKLTLKFIERNFDIENMI