Identifiers and Description

Gene Model Identifier

Contig11813.0.g68

Standard Name

IARS2

Aliases

Contig11813_0_g68

Description

tRNA synthetases class I (I, L, M and V)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam13603 ) Leucyl-tRNA synthetase, Domain 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003709002.0004062814618821e-57Isoleucyl-tRNA synthetase
SGDYPL040C2.000704504372864e-47ISM1 SGDID:S000005961, Chr XVI
from 479001-475993, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11813.0.g68(coding)
ATGTCAATTTTGAAATAAAACAGAACATTAGTTTAATCTAGGTATCAAAGTTTACTGTCT
TGGGAACTATATAATTGGCAACTTATCAATAGACAAGGAAGACCTGTTTGGGCTATACAT
GATGGTCCACCATTTGCGAGTGGTAAACCACATATTGGTTAGTTCTACAACAAAACTTTA
AAAGACATAATAAACAGATATAAGCTTTTACAAGGTTATCAAGTGAACTTTATCAATGGC
TTCGATTGCTATGGCACAACTATAGAAGATCTTGCATTAGCTTAAGACACTGATAAGCAT
AATATCAAAGGATTAAATTTAAGAATCAGTAATGACCAAATAGAAAAATTCACAAATTCT
AGTAAGCAAGAAAAAGATGTCCTCAAAAACAGATAATAAATACGACAATTTGTCAAAGAT
AGCATACTTACTTAAATGTAAAGCTATTCAAATTGGGGAATAATGTCGGACTGGAGATAA
TCTTACTTCACTATGATGCCTGAGTATGAATCAATGGTTTTGAACAAGTTTGCAGATCTA
TTGAGTAAAAAGCAAATATTTAGAGGTGGTAGAGCAGTCTTCTGGTCAATTGATCAATAG
AGAATTATGGATGAGCATCAAATTGAAGAAGTTTAAGAAATTATTGATTGTTCAATTGTA
AAGTTTCCTATTAGAAGGTGTGGAGTAAACACTTAAAAAATACTACAGATGTACCCTGAC
ACAAAGTTTTTAGTATTTCAAACAGAACCATGGAAAATTTTGGGGACAAATGCAGTATCA
ATCCATGAATCAATTTCTTATGCTTTGTGTTCTTTTATGGATGAGTACTTTATTGTTGCA
GAGAAAAGAATTCCAGAACTATAAGTTAGAGTTGGTGCAGAAAATCCAATTAAACCTTTA
ATGATTTTTACTGGAGATTAACTCTCTGATATAACTCTTGATCATCCTTTGATTCCAAGA
CTAGAAGTGCCAATCGTAATTTATAATGGGGTGAAGAGCACATTTGGAACAGGAATTAAT
GCTGTAGCTCCTGGACATGATTTAAATTCTTTGAAAGTGGCAGTATAATATAATCTGCCA
AAGGAAGGATGTGTAGATGAAAAAGGAAACTTAAAAGAATTTCTTGGAGTTGAATTTTCA
AAATTGAATGTGCGAGATAGTAAAACTAATAGTTATGTTCTAAAAATGCTATAACAAGAA
AAGGCTCTTTTCAAATCCTATAAATATCAAAATACATCCTACATCAATACAGAAACTAAA
GAAAGAATAGTCATGATAACAGTAGACTCATGGTTTATGAGAATCTCAGAGAGAATGCAC
GCAAGTTGCTTATAAGAATTAGCATCGATTAAATATGTTCCATAGCTAAATTTAAAAAAT
ACTGAGGAAACGCATCTTGATTATATGAAATTACAAGAAAAGAATAAGACAAAGAAGCAA
GATTTTGATGCTTATTATATAAATTTAGTTGAAGAAATCAATAAGGTGCTGATTGATTAG
GAAATAGTTAGGAACGTTGCTAAAATATTCAAATAAAATGGAGGATCAGATGCATGGTTT
AGTTTGAGTGTTGAAGAGCTTTTGCCAAGGAGATACAAAGATAGAGCAAAAGATTTGATA
AAAGGAGATTAAGTATTTGATGTCTGGTTTGATAATGCTCTTTCCTGGAATTATGTGTAG
GATCAAGAATCATACTAAAGTTACCTTAACAGTTTTGATACCAATCTTTAAGCAATTCCT
CAGACTAATTAATCACAGATAACAATAGAAAATTAAGGACCAGTTATAAATGTGATTGAA
GATTAATCTTAAAGTACAACTAAAAAGAATAGCATGAAAGAGTATTTATAGAGGAAAAAG
CAAAAGAAAATTGACACCTAATAAGAATCGTCTTTGATAGGAAGTTCTCCATAATTACAA
GAATAACAAATAATATACAATCCTTAATTAAGACAACTTTAGCAATAGAGCGAAAATGTG
TTTTAAAATGAGATAACCAGTCGATTTAACAAAGTATCATTTGATAAATTGAGACTATTT
GATGAAGTGCCAGCTATGCAATCAAAGTTCTTACTTAAAGATTAGAAACTTTTCCCATTT
AACATGTTCTTAGAGGGATTTGATTAGCATTCAAGATGGTTCATGTCTAGTTTTATATTG
TCTATTGCATTAACTGGGGAATCACCCTTTAAAATACTTAAAACTCATGGGCTCTTGCTT
GATGAAAGTGGAGAAAAGATATCGAAATCTTAAGGCTCATCAGGAGCCCTAGATCCAGAG
GATTTAATTGAGGGAACTCTAAAATTAGATGGAACTAGAAAGTTTGGATATGGAGTAGAT
GTAGTGAGAGCATGGTGCGCTTACAAAGACACTGATAAGAATATTTTTGTGCAAAAAGAA
CAGCTAGATGAGGTTAACAGAGAAGTGAAGATTTTCAGAGATGTAATTAGAGTATTACTT
CTGAATATTAAAAATCTAGATATCAATAAGCAACCATACAAGTTTGATGAACTAAGTGTA
GTTGATAAAATGATGATGATAAAGCTTTTGTAGTTTTCCACTAAGATGACAGATCTATTT
AATAAGCATGAGTTATCAAAAGTGTATGAGGAGACAAATAAATTCGTTGTGAGAGATGTA
GTGAATTTTTATTTGGACTTTACTAAACACAGAAAGTTCACTGATTCATTAAGTGTCCAA
CAAGTAATGAATAAGCTTTTGAATACTTTGTTGCTTACATCAGCCCCTATACTTTGCTTT
TCATCGCAAGCTGCTTTTGATGACATGTCTGTTAATTTATTCAAAGACTATGAAAAGCCA
CAAACTGTATTTTAGCTTTAATGGTTTAACGATGAAATACAAAGATCAATTGACAGCAAG
TATCTTGCTAAGTTCTAAATGAGAGATCTATTTGATAAGCTTTTAGAAATGAGATTAAAA
TTAAGAGAAGCATATGAAGAATTTATACTTGGTATGGTATCTGGTAGAGATTTTTAAAAG
ACAAGTATCCATTTCATTATTACTTCACCAGATAGCAATGAAGCAGCTTTATTAGAACTA
TTAGAAAATGATCTTGAAGATTTCTTCTTTGGAGTGAAAATCAAGATAGAAACTGAAGAT
GAAAATAAACCAAAGAAAGTAGCACCGCTTAAGACTCTGAGACATTCCTTCGAATATAAA
CCTACAAAAGAGGACTTAGAGAGATAACCCGAACTTACTCCAATTACTTATAATTTCAAA
CTGAGAGTTTATAGAAATAGCATGGAAAAATGCTCTGTATGTAAGAAAGCTAGAATTCCA
AATTAAAAGAATAAGGAAGGGCAGTAAACAATTGAAGTAGAAGGAGATAAAAAAGATCAA
GCTGAAATTAATCATGATTAAGTTTGCAAATCCTGCTTAATTCTGAATTCTTTAGTAAAC
TAGTAATGA


>Contig11813.0.g68(protein)
MSILKQNRTLVQSRYQSLLSWELYNWQLINRQGRPVWAIHDGPPFASGKPHIGQFYNKTL
KDIINRYKLLQGYQVNFINGFDCYGTTIEDLALAQDTDKHNIKGLNLRISNDQIEKFTNS
SKQEKDVLKNRQQIRQFVKDSILTQMQSYSNWGIMSDWRQSYFTMMPEYESMVLNKFADL
LSKKQIFRGGRAVFWSIDQQRIMDEHQIEEVQEIIDCSIVKFPIRRCGVNTQKILQMYPD
TKFLVFQTEPWKILGTNAVSIHESISYALCSFMDEYFIVAEKRIPELQVRVGAENPIKPL
MIFTGDQLSDITLDHPLIPRLEVPIVIYNGVKSTFGTGINAVAPGHDLNSLKVAVQYNLP
KEGCVDEKGNLKEFLGVEFSKLNVRDSKTNSYVLKMLQQEKALFKSYKYQNTSYINTETK
ERIVMITVDSWFMRISERMHASCLQELASIKYVPQLNLKNTEETHLDYMKLQEKNKTKKQ
DFDAYYINLVEEINKVLIDQEIVRNVAKIFKQNGGSDAWFSLSVEELLPRRYKDRAKDLI
KGDQVFDVWFDNALSWNYVQDQESYQSYLNSFDTNLQAIPQTNQSQITIENQGPVINVIE
DQSQSTTKKNSMKEYLQRKKQKKIDTQQESSLIGSSPQLQEQQIIYNPQLRQLQQQSENV
FQNEITSRFNKVSFDKLRLFDEVPAMQSKFLLKDQKLFPFNMFLEGFDQHSRWFMSSFIL
SIALTGESPFKILKTHGLLLDESGEKISKSQGSSGALDPEDLIEGTLKLDGTRKFGYGVD
VVRAWCAYKDTDKNIFVQKEQLDEVNREVKIFRDVIRVLLLNIKNLDINKQPYKFDELSV
VDKMMMIKLLQFSTKMTDLFNKHELSKVYEETNKFVVRDVVNFYLDFTKHRKFTDSLSVQ
QVMNKLLNTLLLTSAPILCFSSQAAFDDMSVNLFKDYEKPQTVFQLQWFNDEIQRSIDSK
YLAKFQMRDLFDKLLEMRLKLREAYEEFILGMVSGRDFQKTSIHFIITSPDSNEAALLEL
LENDLEDFFFGVKIKIETEDENKPKKVAPLKTLRHSFEYKPTKEDLERQPELTPITYNFK
LRVYRNSMEKCSVCKKARIPNQKNKEGQQTIEVEGDKKDQAEINHDQVCKSCLILNSLVN
QQ