Identifiers and Description

Gene Model Identifier

Contig21964.0.g21

Standard Name

IARS

Aliases

Contig21964_0_g21

Description

tRNA synthetases class I (I, L, M and V)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam12022 ) Domain of unknown function (DUF3510)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004928509.997093137033517e-262isoleucyl-tRNA synthetase fami
ly protein
SGDYBL076C9.997093137033517e-262ILS1 SGDID:S000000172, Chr II
from 84261-81043, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21964.0.g21(coding)
ATGCAATCTAAATTCGCAAAAGTGCCCGAGAGGCCAAGCTTCCCATAAGAAGAAGAGAAA
GTATTAAAATACTGGAATGATATTGATGCATTCAAGAAACAACTCGAATAGACAAAGGGT
CTGCCCGAATACACATTTTATGATGGTCCTCCTTTCGCCACTGGTCTACCTCATTACGGT
CATATCGCAGCTGGAACAATTAAGGATGTTGTTACTAGATACGCAACTATGAAGGGACAT
CACGTTGAGAGAAGATTTGGGTGGGATTGCCACGGTCTTCCAATCGAATACGAAATCGAC
AAGAAATATGAGATTAAGTCATCAATTCAAAGAGAAGAGATGGGCGTAAAAGAATATAAC
AGAAGATGCAGAGAGATTGTTATGACATATTCTAAAGAATGGGAACACATTATTGGAAGA
TTCGGTCGTTGGATCGATTTCGAAAATGATTACAAAACTATGGACTGCAATTTTATGGAG
AGTGTATGGTGGACATTCAAGTAAATCTTTGACTAGGGATTGGTCTATAGAGGTTCAAGA
ATCATGCCATTTTCTACTGGTTGCACTACAGTCTTATCAAATTTTGAAGCTGGTTCAAAC
TATAAGAATGTTAGCGATCCAGCTATCATCATCAGTTTCCCATTAGTTGATGAGCCAAAT
GTTAGCTTCATTGCCTGGACAACAACTCCATGGACTCTTCCAAGTAACTTAGCCCTTGCC
ATCAACCCAGATTTCGTATATGTTAAAATTCATGACGAAGAGAAGGACAAGACTTACATT
TTAGCTGAAAACAGACTCGCTTATGTACTTAAGCAAGCTAACATTAAAAAGCATAAGGTT
CTTGAACAAATCCCAGGTCAAAGTCTTCTTGGAAAGCAATATATCCCTCTTTACAACTAT
TTTGAGAGCATGAAAGAGCAAGGTTGCTTCCAAGTGATCGGTGGAAAGTTCGTTACATCT
GATACTGGTTCAGGTATTGTGCATTGTGCCCCAGGTTTTGGTGAGGATGATTACTAAGTA
TGTCTTGCTAATGGTTTGATCCAATCTGGTCAAGCTCCAGTACCAATTGATTTTGATGGT
AACTTTACTGATAAAATTTCCGATTTCAAGGGAATCTACATCAAAGATGCTGATGATATA
ATTAAGGCAGATCTTAAGACTAAGGGTAGACTAGTTTGTGCTGGTCAAGAAGTCCATAGT
TATCCTTACTGCTGGAGATCTCAAACTCCACTCATTTACAGAGCTTTTGATACCTGGTTC
ATTAAGGTGACTGATATTAAAGATCAACTACTTGAGAACAATAAAGACGCTAGATGGGTA
CCAGCATTCGTCCAAGAAAAAAGATTCCATAACTGGCTTGCTGACGCTAAAGATTGGTGT
TTCTCAAGAAATAGATATTGGGGTAACCCAATCCCTATCTGGGTTTCTGAAGACATGGAA
GAAATTGTATGTGTTGGTTCAATTAAAGAACTTTAAGAACTATCAGGTTGTGGAGAAATC
ACTGATCTTCATAGAGAAAGTATTGATCATATTACCATTCCATCAAAGCAAGGAAAAGGA
GTTCTTAAGAGAATTCCAGAAGTATTCGATTGCTGGTTCGAGTCAGGTTCTATGCCATTC
GCTTAAGTTCATTATCCATTCAGCATGTCAGAAGAAACCTTTAACCAGAGATTCCCAGCT
AACTTTATTGCTGAAGGTCTTGACTAAACCAGAGGTTGGTTCTATACTTTGATGGTCATC
TCAACCGCTGTCATGAAGAAAGCACCATTCAAGAATTTGATCGTTAATGGTATTGTTTTA
GCTCCAGATGGATAAAAAATGTCAAAGTCAAAGAAAAATTACCCAGATCCAATGCTTATG
GCTCATAACTTCGGAGCTGATGCTTGCAGATTATATTTATGCAACAGTCCAGTTGTGAGA
GCTGAACCACTCAACTTTACTGAAAATGGTGTTAAGAACATCGTTAAGGATGTATTCTTG
CCTTTGTTCAATGCCTACAGATTCTTGATCCAAAACGTTTCAAGATGGGAAAAAACTACT
CAGAAAAACTTCATCTATGATCCAACTCTTAAGAATCGCCTATTAGAGTAGAAAGATTTT
AACATCATGGATAGATGGATCATCGCTGCCAATCAAAATATGATCAAGCATGTGAGACAT
GAAATGGATAACTACAGATTATACAACGTCGTTAGACACATACTCCATTTCTTAGAAGAG
CTTACCAACTGGTATGTTAGATTGAATAGATCCAGAATGAAGGGTGAGGAAGGAGTTGAA
CAACAACACACTAGTTTGAACACTTTGTTCGATGTTCTTTTGAACAGTACTATCATCATG
TCTTGCATTACTCCATTCATCTCAGAGTACATCTATCAAAACCTCAAGAACGGTATCAAC
ACTGAGGACAAGACCTACTACGCAGAGTCAATTCATTTCCTGAGAATCCCAGACTATCAA
GAAGCTCTCATCAACGAGAGAATTGAGAAGATGGTACAACGCATGCAGTCAACTGTTGAA
AGCGGCAGAAAGATCAGAGACAACAAAACTATCTCCATCAAGAACCCACTTGCCAGAGTC
ATCATCGTTGAAAATGATAAGCAAGCCATTGAAGACTTGCAAACCATCCAGAGTTACATC
AAGGACGAATTGAACTGCATGGAGATGGAAATCGTTGAAGATGAAGCAGAATACGTAAAT
TACGTAGTTGAGCCAGATAACAAGCTCATTGGTCAAGCTTTGCAAAAGGCATACACTAAA
CAATTCAAGGAAAAGATCGCCAAGCTTAGCAGAGATCAGGTTCTTGAGTACTATCAAAAT
GGTCAAATTGCTATTGACGGTGTCACCATTGAGAAGGATTGGTTGAAGATCACCAAGAAG
TTTACTGAGAAATACACTAAGGACCCACAATTCGGTGTAGACTGCAACTTCGAGAGCAGC
GTCATGTTAGACTTGCAAATCAACGACGACTTAAAGCAAAAGGGTGTTGCTAGAGAGCTT
GTAAATAGAGTACAAAAACTCAGAAAGGAAGCTAAACTCAACATTGATGATCAAATTGAA
ATCTTCTACGAACACCCCGCTGAGACTGTATTCGACAAAGTGATCAGCAATAACAACGAT
GCAATTAGAACCTCAGTGAAGGTTCCATTCCTACCAGCATCCACAAGACAATCTCACTAC
GTGAAGATTGCAGATACTGAGTACGTGAACCCAGAAAACCCCACAGACGTCCTTAAGGTA
ACTATCTGTGTGCCATCTGTTACTTTTGATGAAGCCAAGTTACAAGATAAATTCGGTGCT
CACAACACTGATAAAGTCAACTTTGTTAATGATGTCAAGTCATTCGTCCTTGCTCATAGC
CATGATTCACTAAAGAAGAAACTTGGAGACAACAACACTCTTAAATTCAAATTGAACGAC
GTTGCAGTTGAGTTGACATACAAGGAAGACTTCTTCCTCAATGCAGTTGAATTCTTTGAA
AATCACAAGTAATGA


>Contig21964.0.g21(protein)
MQSKFAKVPERPSFPQEEEKVLKYWNDIDAFKKQLEQTKGLPEYTFYDGPPFATGLPHYG
HIAAGTIKDVVTRYATMKGHHVERRFGWDCHGLPIEYEIDKKYEIKSSIQREEMGVKEYN
RRCREIVMTYSKEWEHIIGRFGRWIDFENDYKTMDCNFMESVWWTFKQIFDQGLVYRGSR
IMPFSTGCTTVLSNFEAGSNYKNVSDPAIIISFPLVDEPNVSFIAWTTTPWTLPSNLALA
INPDFVYVKIHDEEKDKTYILAENRLAYVLKQANIKKHKVLEQIPGQSLLGKQYIPLYNY
FESMKEQGCFQVIGGKFVTSDTGSGIVHCAPGFGEDDYQVCLANGLIQSGQAPVPIDFDG
NFTDKISDFKGIYIKDADDIIKADLKTKGRLVCAGQEVHSYPYCWRSQTPLIYRAFDTWF
IKVTDIKDQLLENNKDARWVPAFVQEKRFHNWLADAKDWCFSRNRYWGNPIPIWVSEDME
EIVCVGSIKELQELSGCGEITDLHRESIDHITIPSKQGKGVLKRIPEVFDCWFESGSMPF
AQVHYPFSMSEETFNQRFPANFIAEGLDQTRGWFYTLMVISTAVMKKAPFKNLIVNGIVL
APDGQKMSKSKKNYPDPMLMAHNFGADACRLYLCNSPVVRAEPLNFTENGVKNIVKDVFL
PLFNAYRFLIQNVSRWEKTTQKNFIYDPTLKNRLLEQKDFNIMDRWIIAANQNMIKHVRH
EMDNYRLYNVVRHILHFLEELTNWYVRLNRSRMKGEEGVEQQHTSLNTLFDVLLNSTIIM
SCITPFISEYIYQNLKNGINTEDKTYYAESIHFLRIPDYQEALINERIEKMVQRMQSTVE
SGRKIRDNKTISIKNPLARVIIVENDKQAIEDLQTIQSYIKDELNCMEMEIVEDEAEYVN
YVVEPDNKLIGQALQKAYTKQFKEKIAKLSRDQVLEYYQNGQIAIDGVTIEKDWLKITKK
FTEKYTKDPQFGVDCNFESSVMLDLQINDDLKQKGVARELVNRVQKLRKEAKLNIDDQIE
IFYEHPAETVFDKVISNNNDAIRTSVKVPFLPASTRQSHYVKIADTEYVNPENPTDVLKV
TICVPSVTFDEAKLQDKFGAHNTDKVNFVNDVKSFVLAHSHDSLKKKLGDNNTLKFKLND
VAVELTYKEDFFLNAVEFFENHKQ