Identifiers and Description

Gene Model Identifier

Contig21344.0.g34

Standard Name

HST4b

Aliases

Contig21344_0_g34

Description

Sir2 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008337501.0003081162615753e-33transcriptional regulator, Sir
2 family protein
SGDYDR191W0.00000000000040012475857291343HST4 SGDID:S000002599, Chr IV
from 842337-843449, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21344.0.g34(coding)
ATGGAATCAACACGCTCACTAAATTCAACCACTTACTCAGATTAATCTGTTTAAGATTCG
TTAGACTCACAAGAAGAGAAGATTGAGTTACCTATATATTTATAAGATAAACCCCTCTCA
GAAATGAATGATCAGGAGAAGAACTTATATTATGCACACTTGATGCAGAGTGTCAGGGAA
ACTTAGAGAAATGCAAGGCAAAATATTGAGAAAAGTGCAATTGCGAAGATAGAGATTGAG
TAGACATTAAAGGCAAGTAGAGATGTTGAAGAGAGATATGAGAAATTCAAGTCAGACTTT
GGAGTAGCAATCAATAAACTTGCTGTATCACTCAAAGAAACTGTCACTCCTATGAATGTT
GAGCACACTCACCAACCTAAGCAAGTGAGTGCAATTGATGCTGCCTAATAACTAAAGAAT
TGCAAAGCAATTATGATATTGACAGGTGCTGGATTAAGTGCAGCAAGTGGCATTCCAACG
TTTAGAGGAGACAATGGATTTTGGACTAAGTCATATGGTAATTACTCTGATCCAATGGAA
ATCTTGACAACCAAAACACTTATAAATGATCCGCAAGTATAGTGGTAATGGAGATACGAT
TTCACAGATATTGTTAAGAAGTGTAAACCAAATGCAGGTCATTAAGCAATTTATGAACTT
CAAAACTTCTCCTGGCAAAATCCTACAAAACTCGAGACTTAACTAGTTACTCAAAATATA
GACAACTTTCACATTGATATTATGGAAAAGAATGGAAAGAAATTAAAGAAAAAATAGGAG
GGAACTTATGAGTTTGGATTTGTAGATGAGGTTCATGAAATACATGGCAATAATAAGTAT
ATGAAGTGTTTCAAGGAGTGTAATGACGCTCTATATCTCAGTCCAGAGCCACCAATGGAT
CCGGATGAAAGAAAAAACAAAGTGCCTATTTGTTATTAATGCGGAGGTGTAATGAAATCT
ACAACAATGCTGTTTGATGAAACTTACTCAGAGAAGTGGTATCGTAGTGAAACAGTATCT
TCGTTTCTTTAGGATAAACTGGATGGGCTAATAGTGGTGGGCACTGCACTTCAAACAAAT
TTCGCAAGTCATATCGTCATGAAAACACTAGCAAAGTAAAATATTCCTGTTATTGAAGTA
AACACAGAGCCATGTATTACAACTGGGTATACATTTTAAGTGAAGGAGAGCAGTCTCACT
GCACTTCCAGCTATGGTTAAGAAACTTATTCAATTAAAAACAAGTAAACCCACAGTAGTG
AAGAAAAAGTGA


>Contig21344.0.g34(protein)
MESTRSLNSTTYSDQSVQDSLDSQEEKIELPIYLQDKPLSEMNDQEKNLYYAHLMQSVRE
TQRNARQNIEKSAIAKIEIEQTLKASRDVEERYEKFKSDFGVAINKLAVSLKETVTPMNV
EHTHQPKQVSAIDAAQQLKNCKAIMILTGAGLSAASGIPTFRGDNGFWTKSYGNYSDPME
ILTTKTLINDPQVQWQWRYDFTDIVKKCKPNAGHQAIYELQNFSWQNPTKLETQLVTQNI
DNFHIDIMEKNGKKLKKKQEGTYEFGFVDEVHEIHGNNKYMKCFKECNDALYLSPEPPMD
PDERKNKVPICYQCGGVMKSTTMLFDETYSEKWYRSETVSSFLQDKLDGLIVVGTALQTN
FASHIVMKTLAKQNIPVIEVNTEPCITTGYTFQVKESSLTALPAMVKKLIQLKTSKPTVV
KKK