Identifiers and Description

Gene Model Identifier

Contig3537.0.g67

Standard Name

HST4a

Aliases

Contig3537_0_g67

Description

Sir2 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008337409.995528898049344e-31transcriptional regulator, Sir
2 family protein
SGDYDR191W0.000000000029994712494008525HST4 SGDID:S000002599, Chr IV
from 842337-843449, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3537.0.g67(coding)
ATGAACTAAGCATTTGGTGAGAAATTAATGATGACTTTTGGCTTGGGGAATCCAAACATA
ACTTTAACTCATAAGCCAGAGATTATCTCTTCAAAGGATGCAGTTAAGTATCTAGTTGGA
AAGAAAAATATTTGCATTTTAACTGGGGCAGGGTTAAGTGCTGCAAGTGGAATACCTACT
TTTAGAGGGTAAAATGGATTTTGGACGAAGTCATATGGGGATGAAGTTGATCCTCAGGTT
ATCTTGACAGAGAAATTCTTTTGTAAAAACCCTTAATTAAACTGGAAGTGGCACTACGAT
TTCTATGAGTTAAGAAATAAATGTAAGCCAAATGCAGGCCATCATTCAATCTTGAAATTT
CAAGAGTACTGCCATTAGTCTAAAAAGGCAGAGAGCTTCTTAGTAACTCAAAATATTGAT
GACTATCATCCTAAGTTAATCAAGTAATCTTAAATTTTGATGAATGGCTAAGAAGAGAGA
AAATAAGGCACTAAGGACTTTGCTTTTACCCCCTATGTTTATGAAGTTCATGGAAATGTT
GACTATATGCACTGCTCTGAAGAAGATAAAGATTGCTCAAAACTCTTCTATCAAGCTCCT
GACCTCAAATAAGTAGAAGATATTGAAAATCACGTTCCTATTTGCAAAGAATGTGGAGCA
AACATGAAACCTCACTGTATGTTCTTCGATGAGTCATATTCTGAATAATACTACCGATCT
GATTCAGTGGATAATTTTGTCGAAAATAAAATGGATTGTTTAATTGTCGTAGGAACTGCT
CTTGCTACTGGTCTTGCTAGAAGAATCGTAAACAAGGCTATTGATAAGATTGAGTGTCCA
GTGATTGAAGTCAATTTAGAAACCTCGATCGATAGAGGATTCAACCTCTAAATTTTAGAG
AAAAGTGAGACTGCTCTTGACAACATGTTTAACGAATACTATAGATTAAGTAAGTTACCA
ACAGGTTTGAAAAACAATACTTAAAAACCTCAAATAAAAACAAATAACTAAAATTCTATT
GCTGGAAGAGCAGGAAATGTAAGTGCTTAGCCTAAATAATAACCCAAAAAAGAGGAAATT
AAATCTTAAAAGCCTGCTTTAAATAAACCAGCAATATCTTAACAAAAAACTTAAGTTACT
TAATAAAAAGTTGTTAGCAGCATTAAATCTGTGTAAAAATAGCCAGCTAAGCGCTGA


>Contig3537.0.g67(protein)
MNQAFGEKLMMTFGLGNPNITLTHKPEIISSKDAVKYLVGKKNICILTGAGLSAASGIPT
FRGQNGFWTKSYGDEVDPQVILTEKFFCKNPQLNWKWHYDFYELRNKCKPNAGHHSILKF
QEYCHQSKKAESFLVTQNIDDYHPKLIKQSQILMNGQEERKQGTKDFAFTPYVYEVHGNV
DYMHCSEEDKDCSKLFYQAPDLKQVEDIENHVPICKECGANMKPHCMFFDESYSEQYYRS
DSVDNFVENKMDCLIVVGTALATGLARRIVNKAIDKIECPVIEVNLETSIDRGFNLQILE
KSETALDNMFNEYYRLSKLPTGLKNNTQKPQIKTNNQNSIAGRAGNVSAQPKQQPKKEEI
KSQKPALNKPAISQQKTQVTQQKVVSSIKSVQKQPAKR