Identifiers and Description

Gene Model Identifier

Contig17274.0.g46

Standard Name

HSP90c

Aliases

Contig17274_0_g46

Description

Hsp90 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00183 ) Hsp90 protein
  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam10158 ) Tumour suppressor protein
  • ( pfam12939 ) Domain of unknown function (DUF3837)
  • ( pfam00581 ) Rhodanese-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001585209.997093137033517e-262Hsp90 protein
SGDYPL240C9.997093137033517e-262HSP82 SGDID:S000006161, Chr XV
I from 98625-96496, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17274.0.g46(coding)
ATGTCTGAAGAAGTGTTTGCTTTTAATGCTGACATCCAGCAATTGATGTCTCTGATTATT
AACACTTTCTACTCAAACAAGGAAATATTTCTGCGTGAGCTCATTTCTAATGCTTCAGAT
GCCCTCGATAAAATTAGGTACAGGTCAATTACAGAGCCAGAGTAACTTGAGACTGATACA
CATCTAGGCATCAAGATTATTCCAGATAAATCTAACAATACTTTGACTCTTCTAGATACA
GGAATTGGTATGACTAAAGCTGACTTGATTAATAATCTTGGAACAATTGCAAGATCTGGT
ACTAAAGCCTTCATGGAAGCAATCTCAGCTGGTGCTGACATCTCTATGATTGGCCAATTT
GGCGTGGGTTTCTATTCTGCCTACTTGGTCGCTGAGAAAGTTGTCGTCATCTCCAAAAAT
AACGAAGATGATTAGTACAGATGGGAATCTAATGCAGGAGGAACATTCTCTATCACAAAA
GATGAATCTGGCGAAAAGCTAACACGTGGTACCAAGATTATCCTGTACATGAAAGAGGAT
CAACTTGAATACCTAGAGGAAAGAAAACTCAAAGACCTTGTCAAGAAACACTCAGAGTTC
ATTGGATTCCCAATAGAGCTATATGTTGAAAAATCTGTAGATAAAGAGATCACAGAAAGT
GACGAAGAGGACAAAGACTAAGAGATGAAAGATGAGACTGAACCTAAGATTGAAGAAGTT
AAGCCAAAAGACAAGAAAAAGAAAAAAATCAAGGAAGTGACTCATGAATTTGAGCAACTT
AACAAGACAAAGCCTATTTGGATGAGAAAGCCAGAAGATGTCACCAAAGAAGAATATGCT
TCTTTTTACAAGAGCCTATCTAATGATTGGGAAGATCACCTAGCCGTTAAGCATTTTTCG
GTTGAGGGCTAGCTTGAATTTAAAGCTCTTCTATTTGTTCCCAAAAGAGCACCATTTGAC
TTGTTCGAAACTAAAAAGAAGAAAAATAACATTAAGTTGTATGTAAGAAGAGTCTTTATT
ATGGACGACTGTGATGAATTAATTCCAGAATGGCTTGGCTTTATCAAGGGAGTAGTAGAT
TCTGAAGATCTTCCTCTCAATATTTCTAGAGAAACATTACAGTAAAACAAAATTCTTAAA
GTAATAAAGAAAAACATCGTCAAAAAGTGCCTTGAAATGTTTGCTGAGCTATAAGAAAAC
CAAGAAGACTATAAGAAATTTTATGAATAATTTTCAAAGAACTTGAAGCTTGGCATTCAT
GAAGATTCAGTGAATAGGTAAAAAATTGCTGAACTCTTGAGATTCCATACATCAAAGAGC
AATGAAGACCAAATCTCTCTCAAAGAATATGTTCAGAGAATGAAAGAAAGCTAGAAGGAC
ATATTCTACATAACTGGTGAATCAAGAGCAGCAGTCGCTAGCTCACCATTCCTGGAAGGT
TTAAAGAAAAGAGGATATGAGGTACTTTACCTAGTTGACCCTATTGATGAGTACATGATC
CAATAACTCAAGGAATATGATGGCAAGAAGCTAAGATCTTGTACAAAAGAAGGATTAGAC
CTGGAAGAGACTGAAGAAGAGAAGAGAAGGAAGGAGGATTAAAAAGCCAGATTTGAGCCT
CTTTGCAAGCTCATGAAAGAAGTACTCGGAGATAAGATTGAAAAAGTACAAGTTTCTACA
AGAATAGATGAATCTCCATGTGTATTAGTGACAGGAGAATATGGATGGACTGCAAATATG
GAGAGGATAATGAAAGCTCAAGCTCTCAGAGATTCATCTATGACTTCCTATATGGTCTCT
AAAAAAACCATGGAAATCAATCCCAGCAATCCTATTATTGAAGAACTTAGAAAGAAGGCA
GAGGCTGATCAATCAGACAAAACAGTTAAGGATTTGATCTGGCTACTTTACGACACTGCA
ATTCTTGTCTCTGGATTCTCACTTGATGAACCAAATACTTTCGCTGGTCGTATTCAAAGA
ATGGTCAAGCTTGGCCTTTCCATCTTTGAGGATGATAACAAGGATGATGATGAGTTGCCT
CCACTTGCTGATAGCGTTGATAATGCCAGACTAGAGGAAGCTAACAAAATGGAGGAAGTT
GATTGA


>Contig17274.0.g46(protein)
MSEEVFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYRSITEPEQLETDT
HLGIKIIPDKSNNTLTLLDTGIGMTKADLINNLGTIARSGTKAFMEAISAGADISMIGQF
GVGFYSAYLVAEKVVVISKNNEDDQYRWESNAGGTFSITKDESGEKLTRGTKIILYMKED
QLEYLEERKLKDLVKKHSEFIGFPIELYVEKSVDKEITESDEEDKDQEMKDETEPKIEEV
KPKDKKKKKIKEVTHEFEQLNKTKPIWMRKPEDVTKEEYASFYKSLSNDWEDHLAVKHFS
VEGQLEFKALLFVPKRAPFDLFETKKKKNNIKLYVRRVFIMDDCDELIPEWLGFIKGVVD
SEDLPLNISRETLQQNKILKVIKKNIVKKCLEMFAELQENQEDYKKFYEQFSKNLKLGIH
EDSVNRQKIAELLRFHTSKSNEDQISLKEYVQRMKESQKDIFYITGESRAAVASSPFLEG
LKKRGYEVLYLVDPIDEYMIQQLKEYDGKKLRSCTKEGLDLEETEEEKRRKEDQKARFEP
LCKLMKEVLGDKIEKVQVSTRIDESPCVLVTGEYGWTANMERIMKAQALRDSSMTSYMVS
KKTMEINPSNPIIEELRKKAEADQSDKTVKDLIWLLYDTAILVSGFSLDEPNTFAGRIQR
MVKLGLSIFEDDNKDDDELPPLADSVDNARLEEANKMEEVD