Identifiers and Description

Gene Model Identifier

Contig7273.0.g45

Standard Name

HSP90b

Aliases

Contig7273_0_g45

Description

Hsp90 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00183 ) Hsp90 protein
  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam02862 ) DDHD domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004446709.997093137033517e-262Hsp90 protein
SGDYMR186W9.997093137033517e-262HSC82 SGDID:S000004798, Chr XI
II from 632355-634472, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7273.0.g45(coding)
ATGTTTGGAAAAATTAGACTAACATCTAGAAATTTCCTGCTAGTCCTATTAGCTTTAGGA
GCCATTTTCATTCATGAGACAATCAGAGTATCAGCCATCACTGAGGATGATAACGAGATT
TCTTTGAGAGACGCTTCATCCACCAGAGAGCGTCCCCGCCTAGATGGTTTCGACATGGAT
CAAGATACTGCTACTGAGATTGAGCAATAAAAGGAAGAGTTCTCCTTCAACGCTGATGTG
TCCAGACTTATGGATATCATCATCAACTCACTGTATACCAAGAAAGAGGTGTTCATTAGA
GAATTGATTTCAAACGCTTCAGATGCTCTCGATAAAGTTAGATTCATTTCCCTCTAAAAC
CCAGAGTTCCTTGGATCTAACCCCAACCTCGAGATCCTCATTGATTTCGATTATGACGCT
AAGACTCTCTCCATCACCGATACCGGTGTTGGTATGACTAAGGCCGAGCTCATTAAGAAC
TTGGGTACTGTCGCTAAGTCAGGAACCACTGCTTTCTTGGAAGCTATGGGAAAAGGTGAT
AGCTTGAATCTTATTGGTCAGTTTGGTGTTGGTTTCTATTCTGCTTTCTTAGTTGCTAAC
AAAGTCGTTGTTGCCTCAAAGGCCAACGATGATGAACAACATGTGTGGACTTCAACTGCT
GACGCTAAGTTCTTCGTAACTCAAGATCCAAGAGGTGATACTCTAGGTAGAGGTACAAGA
GTCACACTTCACTTGAAGGACGACGCTGTCGAATATGTTGAGCAAGATAAAATCAAGAAC
TTGGTGAAGAAATATTCCGAATTCATCCAATACCCAATTAAGCTTTTCATCTCCAAGGAG
GTCAGAAAGCAAGTTGAGGAAGATGAGGAAGAGAAGCCAATCGATGAGACCACTCCAACT
GAGGAAGAAACTCCAAAGGAAGACGATGGTGAAATCAAGGATGAAGGTGAAGAAACTGAG
GCAAAGGAGAAGAAGACTAAGACTGTAACTGAGCAAGTTTGGGAATGGGAAACCATTAAC
GAAATCAAGGCCATCTGGTTGAGAGACAAGAGTGATATCAAGGATGAGGAGTACAACAAC
TTCTACAAGACCATCTCTAAGGATCACGAAGATCCATTAGCCTACTCTCACTTCACAGCT
GAGGGTGAAATCGAATTCAAAGCTATTCTTTTCATTCCAAGCCAGGCCCCATACGATTTG
TTTGAAAACTACTACGGCAGATCTTCAGCACTTAAGCTCTACGTTAGAAGAGTTCTCATT
ACTGAGGAATTCGAAGAGCTGATGCCAAGATATTTGAACTTCATTAAGGGTGTTGTCGAT
TCCGATGATCTCCCACTTAATGTCAGCAGAGAGCAACTCCAACAACTCAAGATGATTAAA
GTCATGAGCAAGAAACTCATTAGAAAGGCTATTGAGATGATTAGATCATTGGCCGAAGAA
GATGAGGAGGAAGATGATATCGATGAAGACGATGAAGAATCAACTGAAGAAGCTCAAGAC
ACCAAAGACGACGAAGAGAAATCTGATGAAGAAAAGGAGAAGAAGGACGAAGAGAGCGAG
GATAAATACACCAAGTTCTGGAAATCCTTTGGAAAGAACGTTAAGCTCGGAGTTATTGAA
GATGCCAGCAACAGAAGCAAACTCGCAAAGCTATTAAGATTCTACTCCACTCATGATCCA
GAGACCTTAACTTCCCTTGACGAGTACATCTCAAGAATGAAGAACGATCAAGACACCATC
CTCTACTTGCCAGGTGATTCCAAGGACGCTATCCTTAAGTCACCAATTCTTAAGAAATAT
ATTAAACTCGGTTACGAAGTCCTCATCCTTGGAGATCCCATTGATGAATTCTGCGTACAA
CATTTATCTGAATACGAAAAGAGAAAGGTCAAGTCTATTGCTAAGGATGATGTTAACATT
CTTGACAACGATGAAATCTCAAGAAAGAAACTCCAAAAGCTCAAGGAAATGTACAAGCCA
CTCACTGAATGGTTCAAGAACTACCTTGGCAAACAAGTTGAGAAAGTTACCATTTCAAAC
AAGCTAGATGATGATCCAGTATACATCCTAACCTCTCAATACGGTTACTCTGCATCTATG
GAAAAGATCAATAGAGCTCAAGCTTTTGCCAATCAAGAGAAGGCTGCCAGCTATATGCTT
GCAAAGAAGACCCTCGAAATCAATCCCCATCATCCAGTCATTAAAGAATTACTCCAAATG
GTTAAGTCTGCTGCTGGAGGTGAGGTAGATCAAACTGTCTCAGAATATGCTGACTTATTG
TACAATATGGCTCTCCTGAACTCAGGTTTCTTGATTGAGAACCCATCTGACTTCATTACT
CCACTCCAAAAACTCCTCAGAGTTGGTTTCGGTATTAGAAGAGACGCTCCAATTGAAGAA
ATCGAAGTCGACATTAGCAGTGTTGAAGATGATGAGAGCTCTTCTGAAGAACCAGACGTA
GAAGGTGAAGTAGAGGTTGAAGAAGATGATAATAAAGACAATAGCAGAGAAGAGCTATGA


>Contig7273.0.g45(protein)
MFGKIRLTSRNFLLVLLALGAIFIHETIRVSAITEDDNEISLRDASSTRERPRLDGFDMD
QDTATEIEQQKEEFSFNADVSRLMDIIINSLYTKKEVFIRELISNASDALDKVRFISLQN
PEFLGSNPNLEILIDFDYDAKTLSITDTGVGMTKAELIKNLGTVAKSGTTAFLEAMGKGD
SLNLIGQFGVGFYSAFLVANKVVVASKANDDEQHVWTSTADAKFFVTQDPRGDTLGRGTR
VTLHLKDDAVEYVEQDKIKNLVKKYSEFIQYPIKLFISKEVRKQVEEDEEEKPIDETTPT
EEETPKEDDGEIKDEGEETEAKEKKTKTVTEQVWEWETINEIKAIWLRDKSDIKDEEYNN
FYKTISKDHEDPLAYSHFTAEGEIEFKAILFIPSQAPYDLFENYYGRSSALKLYVRRVLI
TEEFEELMPRYLNFIKGVVDSDDLPLNVSREQLQQLKMIKVMSKKLIRKAIEMIRSLAEE
DEEEDDIDEDDEESTEEAQDTKDDEEKSDEEKEKKDEESEDKYTKFWKSFGKNVKLGVIE
DASNRSKLAKLLRFYSTHDPETLTSLDEYISRMKNDQDTILYLPGDSKDAILKSPILKKY
IKLGYEVLILGDPIDEFCVQHLSEYEKRKVKSIAKDDVNILDNDEISRKKLQKLKEMYKP
LTEWFKNYLGKQVEKVTISNKLDDDPVYILTSQYGYSASMEKINRAQAFANQEKAASYML
AKKTLEINPHHPVIKELLQMVKSAAGGEVDQTVSEYADLLYNMALLNSGFLIENPSDFIT
PLQKLLRVGFGIRRDAPIEEIEVDISSVEDDESSSEEPDVEGEVEVEEDDNKDNSREEL